CAZyme Information: MGYG000000721_01762

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; NC2004
• CAZyme ID: MGYG000000721_01762
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000000721_20|CGC1	36588.11	4.3582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000721	2405891	MAG	Kazakhstan	Asia

• Gene Location: Start: 31184; End: 32134 Strand: -

Full Sequence      

MSTFCKEPVNPQASKEAKELLAYLCEHAGKKLITGQHTQTKPMEERAYIKEVTGKYPKLV
EFEMLSYSPNINYEDAGKECLTEVYENEGTMDTALSLAKEGEIIPMLCFHWFSPIGGQDK
AFYTEHTDFDPEQVLVEGSDEREAFFSDLSVIAEQLSRFKEEHIAVLWRPFHEVEGTWFW
WGSKGGEVAKQLYYLMFDYFTKEKQLDNLLWVWSAPTKESYPGDDFCDVVGWDIYLPEKE
VTDYQKQYEELTANTSPNKVKALTEVGYNPSISAIEKSHTPWAFYMTWSKEFALDGVYNT
KEELKAMYDSDYTITL

Enzyme Prediction     

No EC number prediction in MGYG000000721_01762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	9	316	3.3e-93	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.86e-49	9	315	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.01e-18	114	269	124	298	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	1.21e-141	6	315	2	311
QNM01251.1	1.33e-131	12	316	12	334
AEB13973.1	2.79e-125	7	316	3	310
AZK45707.1	4.86e-114	8	316	6	314
AOZ93051.1	3.55e-112	8	316	9	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	4.96e-53	10	316	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	9.80e-52	8	315	6	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	4.15e-51	8	316	34	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	8.62e-38	6	288	43	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	2.65e-31	8	315	23	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.37e-52	10	316	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	9.60e-49	1	316	21	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	2.51e-42	12	315	150	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	4.47e-38	9	316	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	2.82e-31	9	308	157	448	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000721_01762.