CAZyme Information: MGYG000000722_00545

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_00545
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		26655.4	10.5793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 11174; End: 11857 Strand: -

Full Sequence      

MKKWKRILFLRIPLGVVAFSVVLVAVLKYVPIHWTPLMLKRSIEFRDDRKFRTRQAWVPL
EKISGNMEKAVILSEDASFRSHMGFDFEEMRKMLKEHRKRGTKIRGCSTISQQTAKNVFT
FCTDTWARKAVEAYWTVLIELIWGKDRIMEVYLNVVEMGRGIYGIEAASQFYYGHSCTRL
SPAEAAAIACCLPRPLRRTPHWVMNKRTYKYRRVLREISNISEKLSD

Enzyme Prediction     

No EC number prediction in MGYG000000722_00545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	52	214	2.5e-47	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.94e-81	1	201	4	206	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.88e-64	2	196	1	196	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	3.31e-54	49	216	7	174	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	8.19e-53	1	201	14	223	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.39e-31	54	217	66	233	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53411.1	8.21e-60	6	198	14	205
AWA29318.1	2.30e-59	8	195	32	219
AWI25143.1	7.42e-58	15	195	42	219
AWG24205.1	2.04e-57	2	214	3	218
BAR49817.1	2.03e-56	19	200	21	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	5.94e-22	54	217	19	186	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.28e-21	54	217	19	186	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	5.71e-17	44	200	33	184	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	4.04e-15	44	189	34	174	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3UDF_A	2.41e-14	58	189	40	173	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q11VI0	1.92e-49	1	200	13	213	Biosynthetic peptidoglycan transglycosylase OS=Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465) OX=269798 GN=mtgA PE=3 SV=1
Q1QYT5	2.88e-49	14	195	18	199	Biosynthetic peptidoglycan transglycosylase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=mtgA PE=3 SV=1
Q8A8H2	1.21e-48	18	197	23	202	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V7R3	5.12e-48	28	227	31	230	Biosynthetic peptidoglycan transglycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mtgA PE=3 SV=1
Q9ABA6	7.95e-48	6	197	10	195	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29