CAZyme Information: MGYG000000722_01148

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_01148
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39997.04	4.6519

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 37404; End: 38468 Strand: -

Full Sequence      

MNRMKILIMALLVTACIKNGGEAVEEPLLKDFALKVNELSYHANLDKESGMATIGVIEYG
GYVSGVSVDLADGATISPNPNDFLGSWPQSQEFIVSKGEVSQKWTVRLTKYVSELPQIDG
KDVIFRDEFDTDGEVNSEFWSLIGKGTAAWQTDMSGKAEHSYVKNGNLVLVIKRDDDGVV
RSGGIRTEYKVGIKYDCHIEARIKFVDDCDNAGQAFWLMPDSRYQIYKGWPDGGEIDILE
HSYLHDYIQQTVHSHYIDVVDPNNKYAGKPVYKGYNPGQYNIYGLDLLENSLVFYTNGEK
TMTYENMHLDNESEMKQWPFTSDYYIILSTSPVGAKNLNAPSYMYVDWVRVTKL

Enzyme Prediction     

No EC number prediction in MGYG000000722_01148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	126	351	6.8e-35	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16341	DUF4971	8.97e-52	1	129	1	139	Domain of unknown function (DUF4971). This small family consists of uncharacterized proteins around 370 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
cd08023	GH16_laminarinase_like	9.81e-44	125	351	1	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.52e-20	127	352	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02178	GH16_beta_agarase	1.66e-18	127	353	27	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd02182	GH16_Strep_laminarinase_like	1.06e-12	120	351	1	257	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL05229.1	9.15e-116	9	354	13	357
BBL13671.1	4.50e-115	9	354	19	363
BBL13664.1	1.48e-75	115	354	308	546
BBL05222.1	1.61e-74	115	354	308	546
QIU93191.1	1.60e-63	29	354	39	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	6.89e-23	122	350	30	259	ChainAAA, Beta-glycosidase [Bacteroides caccae]
6JH5_A	2.15e-12	123	351	6	230	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	1.33e-11	123	351	6	230	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
3ATG_A	2.03e-08	122	351	4	237	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	3.33e-08	144	354	36	244	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	9.22e-25	95	354	36	289	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	1.67e-09	122	351	41	281	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000722_01148.