CAZyme Information: MGYG000000722_01282

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_01282
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1307		144944.98	5.688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 148; End: 4071 Strand: -

Full Sequence      

MRIVVLAALFCVSAFARGNDRTGADETEFVLVEAESFVQKGGWCVDQQFMDQMGSPYLIA
HGMGVPVEDATTSVQLKKGLWNVWVRTYNWTSPWTDKEGPGAFSLSVGGKALKTVLGTTG
SEWGWQHAGAVKVRGGKTEIRLHDLTGFDGRCDAVLLVSGGALPKLPASGEGLDEFRKGL
SGAVAPAREKFDFVVVGGGIAGMCAAVAAARNGLKVALVNDRPVLGGNNSSEVRVHLGGS
VEVGPNEGLGRMIREFGHTKRGNAGPASNYEDDKKLNFINAEKNVRLFAPYHAVSVETDP
SDGRIVFVTARHIENGSELVLEAPLFADCTGDGTIGTLAGADWTQGREARSEYGESLAPE
EADSMTMGASVQWYTRKDSHPTSFPEFSYGLEFNDNNCEKVTMGEWTWETGMHRDQVLEA
EFVRDYGLLVVYSNWSWLKNHSGDPKFSDRSLDWVAYIAGKRESRRLLGDYVLTQNDIDG
NIAHDDASFTTTWSIDLHFPDSGNSKNFPGGEFKSATVHNWIYPYAVPYRCLYSRNVGNL
FMAGRDISCTHVALGTVRVMRTTGMMGEVVGMAASLCHKYGCLPRGVYSGHLDELKAMMK
AGAGRRDVPLSDQTFNEQNCLLAAPANEAPERKTIPTRKFYSCRATLESDTLRLSNSLIE
RTFLWNGGDLISLSIKDLKTGRVFTNKSAEPSFVVTSETVPATDGKFSTRLVASDGIHPV
HLEAEVSYSLGTTRILRVFRLYDNCPAIACDNYVCGADASVEREGGNTADNKNIESAADM
KQKKKRSPYLETLSLDGVHWHCRAVEFFDVTDWNNNLVAERDFIPYRRTGYRGNILFARD
GRDGNGFFFLKEAPCSSVQLGYPGSDFVCEFGNFTVSGIGASEADLKSSDWVKLYSCVTG
VFGEGELSPLKALRAYQKNIREHRPERDEMIMMNTWGDRSQDSKVNEAFCLAELEKAARL
GVTHFQIDDGWQEGKSPNSSVAKGSFRNIWDNPLYWTPAKDKYPHGLAPVVEKAKELGIE
LGLWFNPSVQNDFEDWEKDVEAVVKLYREYGIRVFKIDGLSIPTKKAETNLRKFFDTVLE
KTDNQVVFNLDVTAGRRGGYNMFNEYGNIFLENRYTDWGNYYPYQTLRNLWQLSRYVPAE
HLQVEFLNKWRNPEKYAGDPFAPSSYSFDYVFATSMAGQPLAWMEASNLPEEAYGIAGLV
GAYRKVMKDFHKGTVLPIGEEPSGCSWTGFQSVSSDGRSGFVLVYRELNERGTAVLDTWL
PENAVVEFTKVLGSGEDFSVTAGRHGEVEFSLPKANGFVMYKYKIVK

Enzyme Prediction     

No EC number prediction in MGYG000000722_01282.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12831	FAD_oxidored	9.47e-69	192	599	1	420	FAD dependent oxidoreductase. This family of proteins contains FAD dependent oxidoreductases and related proteins.
cd14791	GH36	5.77e-18	931	1060	4	153	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.12e-09	914	1027	21	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	9.78e-08	917	1059	280	399	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14790	GH_D	6.35e-04	935	1060	7	108	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT68860.1	7.33e-132	1	636	1	654
ARD41468.1	3.62e-12	895	1031	276	400
QLE92119.1	8.01e-12	931	1084	296	430
ACQ93716.1	8.01e-12	882	1084	250	429
QDI10959.1	1.06e-11	931	1081	294	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JHP_A	1.49e-07	886	1031	320	459	Crystalstructure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']
6LCJ_A	9.21e-06	943	1027	171	236	TtGalA,alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_B TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_C TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_D TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_E TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_F TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCK_A TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCK_B TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCK_C TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCL_A TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8],6LCL_C TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8],6LCL_E TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16551	9.72e-11	923	1081	276	425	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999056	0.000222	0.000151	0.000142	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000722_01282.