CAZyme Information: MGYG000000722_01975

Basic Information

• Species: RC9 sp900545245
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900545245
• CAZyme ID: MGYG000000722_01975
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722		80169.77	5.2799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000722	2915024	MAG	Kazakhstan	Asia

• Gene Location: Start: 2725; End: 4893 Strand: +

Full Sequence      

MKTKHFLLAALPLLSVMLGSCSDVIYENEDFSWSSEKVTQGDYSAYAKSENEIVSNYPLP
DGKERRWTKKNDISIFGKYTGTDTLETALYNMAADELLNNVEADSTFRTGALWAGVWTRD
ISYSIILSLSDLLPDISRISLMRKVDRLGRIVQDTGTGGSWPCSSDRVIWAVAAWKIYLA
TGDKNWLNQAYATIKRSLEDDLAVTFDAETCLFRGESSFIDWRQQSYPRWMQPADIFKSE
CLGTNVVYYMVLQAMTKMAATQGFEDDREYYSSLAENLRDAINRELWMEDCGYYAQYLYG
RDHLSISPRSETLGESLAILSGIASEKQAEKIVSQMPVSAFGPTIFWPQIGGEKAYHNNA
IWPFVTSFYALASARAGNGQAVLHALASNVRAAALFATNHENMVASDGSLKTALNSPNML
WSLAGFLGTFRKLLLGIDIREDGISFSPFVPRELGGCRKLEGLKYKNMTIDLTVKGYGRG
IKSFRLDGKKTSAFLPESLEGHHCVEIVLDGRQGKRGRINQCSYTATPDTPNAVIENGVL
VWEPVDGAGAYIVLRDAKAIAKTTQLSYSLDTEGEYQVIAEGNDGIRSFASEPLRFCREG
NVMEIAVEKWLSRGEGIEGITVNIPADGRYFIDWKYANGNGGVTDKNMCATRSMFVDGVP
AGMSVFPQRAYGDWENFGWSSSCALDLTAGEHKISLKFLPCNENMNIDGNKARIAALRIA
RY

Enzyme Prediction     

No EC number prediction in MGYG000000722_01975.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	169	386	1.8e-23	0.35912698412698413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.72e-13	152	295	89	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3459	COG3459	1.60e-11	242	511	753	1054	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
COG3408	GDB1	2.25e-10	111	473	279	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04083	CBM35_Lmo2446-like	3.84e-08	620	708	41	121	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04080	CBM6_cellulase-like	1.49e-06	621	708	62	139	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG27199.1	2.53e-203	64	721	212	892
QEC42842.1	3.30e-201	50	719	199	892
BAU55184.1	5.18e-197	50	721	214	906
QNK61875.1	1.80e-196	67	719	216	888
QJX46424.1	1.99e-191	67	721	231	909

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000098	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000722_01975.