CAZyme Information: MGYG000000723_00191

Basic Information

• Species: CAG-177 sp003514385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp003514385
• CAZyme ID: MGYG000000723_00191
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000000723_1|CGC2	38839.89	6.4996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000723	2208348	MAG	Kazakhstan	Asia

• Gene Location: Start: 194404; End: 195456 Strand: -

Full Sequence      

MTKRILSVLVAISLMFALASIGMAKSSSDDIIVSATKEMIFDKKITDSCHASTVLPLDDG
SVIAAWFGGSSEKKSDVKIYTSVRTEEDGWSDPIVVSAADDIAHWNPVLFQKEDGTVVLY
FKVGTDTDYWKTYYATSTDGRSWSTPRELVPGDNSGGRGPVKNKPIRLKDGTVLAPASTE
IDGEWRAFVDISTDDGATWTKTANVDSKYCTWFKVPMIQPTLWQSADGSVHMLTRTKVGK
IYRSDSYDNGKTWCRAYATKLPNNNSGIDLDTDNQGRIFLAYNNIGLPGIRTPLVLSVST
DDGKTFTKIKTFEKGLAEYSYPSVVVKGDTIHITYTYERDYIAYWQIKIK

Enzyme Prediction     

No EC number prediction in MGYG000000723_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	44	340	9e-28	0.9122807017543859

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	8.43e-92	60	333	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	1.33e-51	49	344	33	368	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	2.88e-51	46	340	11	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam15902	Sortilin-Vps10	0.002	191	340	5	142	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
cd08984	GH43-like	0.007	109	201	138	217	Glycosyl hydrolase family 43. This glycosyl hydrolase family 43 (GH43)-like subfamily includes uncharacterized enzymes similar to those with beta-1,4-xylosidase (xylan 1,4-beta-xylosidase; EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanase and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFC30937.1	3.55e-100	32	345	7	326
AEI43278.1	3.55e-100	32	345	7	326
ACX65278.1	1.12e-97	37	350	8	326
AFH63259.1	5.29e-97	37	345	12	326
QHT72060.1	1.18e-94	37	345	11	322

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000268	0.999111	0.000170	0.000156	0.000138	0.000136

TMHMM  Annotations     

start	end
5	24