CAZyme Information: MGYG000000723_00298

Basic Information

• Species: CAG-177 sp003514385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp003514385
• CAZyme ID: MGYG000000723_00298
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	MGYG000000723_1|CGC4	90713.35	4.9958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000723	2208348	MAG	Kazakhstan	Asia

• Gene Location: Start: 317206; End: 319683 Strand: +

Full Sequence      

MKHADLISQMTLEEKVAFCSGSDYWHTASIERLGIPSILWSDGPHGIRNSVGTHDKDEPK
KKDKKGEGMDALLGGIPAVCYPTAATTACSWDPELIYGMGELLGEECIAEKVSVLLGPGT
NMKRSPLCGRNFEYFSEDPYLAGKMSAAFINGVQSKGIGTSLKHYAVNSQETRRMTVSAV
VDERTLREIYLTAYEIAVKESQPWTIMCMYNRLNGVYGAENKWLLTDVLRHDFGFEGMIV
TDWGAENDRVLGLLAGQNLEMPTSNGDGNRKIYDAVKRGEISEDFLDEMVDGVVDVIMRA
KEVLADGKGYNAGEHHAAARKIARESMVLLKNDDNILPLSKKAKVAVIGQMAKKPRHQGA
GSSLVNSIKIDSAYNTMFEEGIDVIYADGYAMTKKEKKNSPETYIADAVEAAKKADVAVL
FIGLTDEFESEGFDRTHLRIPPEHVALLSAIRGVTENIVVVLAGGAVVEMPWIGETKALL
NSYLGGEASGSAVTDILFGDVNPSGKLAETYPFSLEDTPCYNNFPGHTATVEYREGLYIG
YRYYDTAKKNVLFPFGFGMSYTTFEYSDLKVSADSIKDTDTLKVSFKIKNTGDRDGAEVA
ELYVAQENSTIFRPEKELKGFKKVFLKAGEEKEVEIELSKRAFAFYDVDLGDWHVETDNY
KILVGASSRDIRLEGSVKVESTVDAPVKDLRETMPAYYSADVMNVPDDQFKALLGHEIPE
SEIHDYPNLTFANTLEDSACGKNGAKLCKMLRKFVGSEGMACSIALQTPVKNFVSMSMGV
FSEELGHQLLDILNDKKPMGRGILVLIGKAIPAVVKGLPNLLKNI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	262	8.3e-63	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.95e-100	81	672	120	758	beta-glucosidase BglX.
COG1472	BglX	4.79e-66	25	355	50	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.50e-58	6	636	56	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	9.10e-56	327	541	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.09e-31	32	290	63	310	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX02594.1	3.20e-270	6	794	8	755
ANW99954.1	1.29e-269	6	794	8	755
AGC67337.1	4.32e-269	6	794	43	790
AGI38398.1	4.32e-269	6	794	43	790
AUS96756.1	8.94e-266	6	796	8	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.48e-257	6	795	8	753	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.97e-217	7	671	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.19e-131	5	679	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	7.14e-130	6	680	9	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X42_A	7.88e-130	5	679	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	9.11e-257	6	795	8	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.01e-204	7	680	9	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.85e-204	7	671	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q2U8Y5	1.30e-133	7	682	10	833	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	3.59e-133	7	682	10	833	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000723_00298.