CAZyme Information: MGYG000000723_00681

Basic Information

• Species: CAG-177 sp003514385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp003514385
• CAZyme ID: MGYG000000723_00681
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	MGYG000000723_1|CGC9	82023.22	4.6523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000723	2208348	MAG	Kazakhstan	Asia

• Gene Location: Start: 725753; End: 727939 Strand: -

Full Sequence      

MNFSELFGNAQWVACDSGCTSPVIKGGFFIEEPKEAEITICGLGFFRLWINGREVSEDKF
VPVNSQYCKRDLTAFEYPILDELSYRTYAVRYDISKFVVDGKNDIRVILGCGWFAQQKRS
AEGFAKYGDIKLCYKIDAENKSGKKYTFVSDDSLEWKQSRIIENNIYFGEVHDMSLADEL
TANSGFQNVIKAPAHETQFFVQDCPADRVERVIKPVKLFDLGEVSIYDMGENISGYPVVA
ATVDGANITVRCSEEINPDGTLNFDSCDRGQIQKDEYRNAKKGEECMPWFTWHGFRYFEL
TNNAEPVRCEVVHSDCAVTSSFESGSEMLNWLYDAYIRTQLSNMHSGVPSDCPHIERLGY
TGDGQLCCEAAMMLLDSQKFYKKWLEDISDCQSIGNGHVQHTAPFMGGGGGPAGWGGAIA
VVPYEMYKIYGDKETFRRYLPKILRYFDYLDSRSSGGLVCREEEGGWCLGDWCPPEQITI
CEPFVNTALYVKQMMMTKEASEAIGESETAAMLEKRIEEKKQAILNAYYSPQTGSFIGDA
QGANSFAIDIGLGGERAFNNTKKKYDAADAFDTGIFGTDILTRVLFERGCADTAFHLLTS
TGKGSFYNMKKQGATTIWENWDGERSHSHPMFGAVTRYLFSFILGITQEKNSAGYEKIVI
APQIPDGLNRASGHITTVRGEIAVSFIRTEREMDFYVTVPQKSWFTYGSDCEYELWEGEN
HIHIDFEE

Enzyme Prediction     

No EC number prediction in MGYG000000723_00681.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	224	703	4.8e-119	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.35e-73	319	643	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.12e-24	32	209	2	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.92e-11	224	313	7	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.52e-06	652	700	6	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	2.61e-222	7	725	3	725
BCJ98018.1	1.51e-130	12	700	127	849
QOY86540.1	1.55e-127	10	700	132	833
QUT50058.1	1.24e-111	8	700	146	849
QBE96295.1	9.94e-109	10	700	124	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	9.42e-69	21	727	176	903	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.30e-53	10	683	285	961	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.66e-33	31	680	142	810	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	8.03e-59	31	700	195	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.11e-54	31	700	185	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	6.86e-53	10	683	285	961	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000723_00681.