CAZyme Information: MGYG000000723_01343

Basic Information

• Species: CAG-177 sp003514385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp003514385
• CAZyme ID: MGYG000000723_01343
• CAZy Family: GT4
• CAZyme Description: Putative glycosyltransferase EpsF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000000723_2|CGC4	40182.9	5.7714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000723	2208348	MAG	Kazakhstan	Asia

• Gene Location: Start: 130571; End: 131653 Strand: +

Full Sequence      

MRILHFVPDIGVANGVMSVVLNYFRAMPEDIKFDIMYFKECERDRRAEIEALGGRVFRIN
TPGIKSFVSSELDGFFEEHKGEYAAVHIHAPYMTCLIAPKAKKHGIKKVAAHCHSTLFSL
NPDNLRRNQLLNVPTRFLADKLFACGREAGRYWYGKDSRFTVLPNAIDCASYAFSSEKRS
AARDEFGIGDSTLVVGHVGVTSPPLKNHPYLMRVFAEIKEEHPDAVLLMAGAEETDELKE
LAEGLGISESAHFLGRRSDISQLLSAMDAFIFPSFREGLPVSVVEAQAAGLPVLMSDTVT
DEVCITDHIKRLSIDADPASWAKEVETMPDDLRASAFEKVRDCGWDINKCANTLVDFYER

Enzyme Prediction     

No EC number prediction in MGYG000000723_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	204	328	4.3e-24	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03812	GT4_CapH-like	5.48e-93	2	349	1	352	capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
cd03811	GT4_GT28_WabH-like	7.15e-38	2	298	1	294	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03807	GT4_WbnK-like	1.18e-36	2	297	1	295	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03801	GT4_PimA-like	1.13e-34	76	359	76	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.98e-27	1	360	1	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEJ74665.1	6.32e-77	2	358	5	367
AHF07665.1	4.33e-75	2	358	5	365
QDP41459.1	7.37e-72	2	358	3	364
AGC67173.1	2.01e-71	2	358	5	362
AGI38250.1	2.01e-71	2	358	5	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IW1_A	6.81e-09	138	308	143	307	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]
2IV7_A	1.61e-08	138	308	143	307	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]
6N1X_A	1.59e-06	174	291	182	298	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	1.67e-06	174	291	198	314	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71055	9.14e-40	2	358	7	374	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
Q5YP47	2.51e-11	139	331	178	382	D-inositol 3-phosphate glycosyltransferase OS=Nocardia farcinica (strain IFM 10152) OX=247156 GN=mshA PE=3 SV=1
A4FQ08	4.30e-11	129	360	173	417	D-inositol 3-phosphate glycosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=mshA PE=3 SV=1
O05083	7.73e-11	124	294	119	283	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
B1VEI4	5.67e-09	158	338	188	381	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) OX=504474 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000723_01343.