CAZyme Information: MGYG000000723_02058

Basic Information

• Species: CAG-177 sp003514385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp003514385
• CAZyme ID: MGYG000000723_02058
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		86451.76	4.6214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000723	2208348	MAG	Kazakhstan	Asia

• Gene Location: Start: 5024; End: 7327 Strand: +

Full Sequence      

MFSGKFICAGYDYTTYTFHVPAPYFRKTFEIDGEVKKCVITLTGLGFYELYVNGQRLTKG
ILAPYISNPDDLVYYDEYDITECLVPGKNVLGIMLGNGMQTAPGGQIWDFDIAAFRGAPR
TAFCVSTEYIDGGIDTFEADGSVKTAPSPVIFDDLRCGCYYDARLEIPGWSEPDFDDSAW
KNALPAETPRGEKRLCEAEPIVPVREIKPVLIRKCRLKEYITRGDVVKEAKKIASDERDG
FLYDFGVNSAGTVKLRISGERGRQIDLQFGEYFAPDGEPDTSNICFYPAGYSQRDVYILK
GEGEETFEPVFTYHGFRYCVVLGITEEEATSDLLTFVVQNSALREIGSFVCSDDMTNKLQ
AMTRNSDLSNFYYFPTDCPHREKNGWTGDAALSAEHILMNLDAVNSYREWLRNIRAAQRA
DGALPGIVPTGGWGFEWGNGPAWDAALTYIPYFCYVLRGDRKIIEENATAIFRYCEYISR
RRDERGLVAIGLGDWCPVTRVKSPLEFTDSVTCMSILKKAAYIFSQLGLSLEREFCEKLY
NEIRDAVRRHLIDFGTMTAIDSCQTSQAMAIYYDVFNPGEKPEAFKRLLEIIKRRDDHVD
AGILGMRVLFRVLSDFGEADLAFKMITRPDYPSYGNFVERGLTALPEDFLREEDRPNSLN
HHMFGDISAWFIEYIGGIRVNPFLADPSEVEISPVFIEKLGSAEASYETVGGKVSVKWRR
TLEGIALDISADSGVHGRIRLPDGYSFADERGSIEELHSGNFEIIRE

Enzyme Prediction     

No EC number prediction in MGYG000000723_02058.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	741	1.4e-124	0.9900793650793651
CBM67	22	186	5.2e-30	0.8636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.63e-78	344	675	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.02e-34	33	201	1	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.43e-25	241	338	8	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.87e-04	689	744	11	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO32478.1	1.50e-266	219	580	1	362
QGQ94103.1	9.97e-152	20	756	141	850
ANH83620.1	7.89e-148	21	764	139	872
QDK77891.1	2.26e-147	21	764	157	875
QMW03094.1	8.59e-147	21	764	156	874

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.99e-120	22	742	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.34e-87	26	758	306	1006	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.57e-67	25	718	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.01e-97	22	718	184	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.00e-86	26	758	306	1006	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	8.08e-79	24	742	176	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.59e-72	24	746	172	883	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000723_02058.