CAZyme Information: MGYG000000724_01156

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000000724_01156
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	MGYG000000724_105|CGC1	70061.06	6.128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000724	1919940	MAG	Kazakhstan	Asia

• Gene Location: Start: 1150; End: 3018 Strand: -

Full Sequence      

MPENNKPNNERPADLAVQDSVGGMARRLLNPAHLRDLAGRSVKTLREQGAEQLWRDVKFR
VGLAMHHDDWRHRADIPLRRELKAQRAANLQGPKISIIVPLYNTPAKFFDEMLQSVVKQT
YTNWELVLVDASDADKRLESRLSKAVPGVIVYEPIENGGIAANTTRGFELAHGEFIALLD
HDDVLYPNALFEVVQTIQNTGADFVYSDEIVLSADLKELGGYHFKPDFAPDYLRGVNFIT
HLAVFSRPLLDAAGAYESKEFDGAQDHDLILRLTEKAHRIEHIKKVLYIWRGHAGSTAAG
MEAKPYAIAAGERAIDAQLERLGLPGHAMAVPDAPGAFQVRYELTGHPKISVLIPNKDHT
DDLDRCLTSLYKNAGYDNFEVIVIENNSTDPATFAYYEMLPSRFADCRVVYYKGTFNFSA
INNFGATFAEGEHLLLLNNDIEVLAHDFLRELLSYSQRPDVGAVGAKLYYPDDTIQHAGV
LMGINGSAGHSHKSYPRTAVGDMYRLVTTQDYMAVTGACLMTKTALYRAFGGLDEEKFAV
AYNDVDYCLKLWQKGLLNVYTPRAEAYHYESKSRGLDTLSENTKRYEREKANFYAKYAQY
IDNYDPYYNPHFNNLFENFGLK

Enzyme Prediction     

No EC number prediction in MGYG000000724_01156.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	96	206	2.5e-20	0.6588235294117647
GT2	348	590	3.5e-17	0.9652173913043478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.60e-74	93	291	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.42e-39	352	570	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.00e-29	348	600	3	250	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	4.76e-26	96	297	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.02e-20	97	280	1	154	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	1.67e-167	94	622	97	629
QUC66692.1	1.46e-164	85	622	408	946
QNM02106.1	3.41e-164	93	622	116	678
QMW89744.1	2.55e-163	94	622	84	615
BBK78193.1	2.55e-163	94	622	84	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	9.18e-09	93	207	5	119	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5HEA_A	5.02e-07	92	203	4	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.24e-117	92	610	365	886	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.86e-87	77	622	302	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	6.03e-12	93	457	13	395	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
A0A0H2UR96	6.13e-11	95	205	5	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q68X33	9.61e-11	89	227	4	139	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000724_01156.