CAZyme Information: MGYG000000725_00584

Basic Information

• Species: Dialister sp000434475
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp000434475
• CAZyme ID: MGYG000000725_00584
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	MGYG000000725_12|CGC1	63400.61	9.3418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000725	2192750	MAG	Kazakhstan	Asia

• Gene Location: Start: 28628; End: 30295 Strand: -

Full Sequence      

MSTKRQKRERKQAQLAKENERSTLISFISFFIIAFLFFLWGSWLLPITDPVESNYALTAR
EMVKSGDWMSPQIYGVYWYDKPIMVYWLLSLAYSVLGFTDLAARLPAVFTGALSVTLLIW
YLRRILKDNVVSIWAGVMLATSLECWVISHAIITDSILLLFTIPTMFSAYIGITENRKKH
LVIAYAAAGLACLTKGPVGLVLPGLLLVIWCLSMKEPKTILRLFPWQGLLAFFAIVLPWY
GGMYAIHGSDFINEFLGLHNVLRATSSEHPEDNHWYYYLILLPASLLPWAFVSFYEMKMR
WKEKGAFYLFLMVWCWGTILFYTLMATKYVTYSYIAVIPAITFAAFGALRIRMGEKLPSI
LGGLGLLILMAALLVGTFRLKEGNWLVFYAVLAYGLFAYLIRWKANQYKRLTIISAVTAS
AFLCCISEGLPHFMMTRSAFEIDSAIQEEKGKHYFFLTYPASYSYYTGDITTRLLPDEPL
LNQEKRDARWDKKSPIPTVNEEQFIEAAKASDRPSYLYVANGKAKFFDAWSLAPRFEKVE
STKAGTIYRFVGTSD

Enzyme Prediction     

No EC number prediction in MGYG000000725_00584.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	24	450	2e-91	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	5.89e-37	40	351	23	339	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.33e-26	50	332	31	317	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	8.63e-17	80	239	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.79e-12	52	247	32	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	2.14e-06	75	351	56	375	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24579.1	3.11e-242	1	548	1	548
AOH39318.1	1.23e-176	18	555	7	541
AXB83023.1	7.67e-127	32	550	12	534
QQB17174.1	4.00e-118	31	546	11	530
SNV02078.1	4.00e-118	31	546	11	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.40e-19	47	290	54	300	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4TBG8	2.00e-30	31	385	7	373	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
Q57M54	7.80e-28	31	366	6	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=arnT PE=3 SV=2
A9MJC5	8.83e-26	31	377	7	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=arnT PE=3 SV=1
O52327	3.80e-25	31	385	6	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=arnT PE=1 SV=2
B4TPI4	3.82e-25	31	385	7	373	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000004	0.000034	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
25	47
76	98
105	122
132	149
156	173
188	210
223	245
275	294
306	325
329	351
358	380
384	401
413	435