CAZyme Information: MGYG000000725_01406

Basic Information

• Species: Dialister sp000434475
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp000434475
• CAZyme ID: MGYG000000725_01406
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22516.87	6.1284

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000725	2192750	MAG	Kazakhstan	Asia

• Gene Location: Start: 9295; End: 9891 Strand: -

Full Sequence      

MRTALKRKKREVHRHQGNTGAMLFTLLLAILCGLAVYILSDISFMRPSREISLLISESAK
KEEISPALLEAVILTESKFDKKAVSHVGAIGMMQLMPDTAEWISEESGLPANRLERPEEN
IPLGAWYINYLLKEYHNNEILALAAYNAGRGNVDQWMKDYGWKEGFSDMNQIPFPETREF
VKSVTASRDRLEAEQTEK

Enzyme Prediction     

No EC number prediction in MGYG000000725_01406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	58	195	8.9e-30	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.52e-70	54	190	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.61e-54	54	188	9	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.03e-41	66	186	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.09e-33	55	166	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.77e-30	21	198	93	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	7.58e-101	1	198	1	198
AOH39655.1	3.26e-60	17	194	13	189
CCC73618.1	5.86e-47	54	184	13	146
AVO73570.1	1.55e-46	54	184	45	178
AVO26251.1	1.55e-46	54	184	45	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	1.34e-21	59	187	428	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.34e-21	59	187	424	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.35e-21	59	187	434	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.36e-21	59	187	438	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.36e-21	59	187	444	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	8.21e-20	55	186	64	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.43e-18	54	186	483	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	1.66e-17	62	186	491	620	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.66e-17	62	186	491	620	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31976	3.08e-16	55	187	1426	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000041	0.000000	0.000000	0.000000	0.000014

TMHMM  Annotations     

start	end
20	39