CAZyme Information: MGYG000000726_01353

Basic Information

• Species: CAG-180 sp004556705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-180; CAG-180 sp004556705
• CAZyme ID: MGYG000000726_01353
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	MGYG000000726_6|CGC1	97602.13	5.654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000726	1857870	MAG	Kazakhstan	Asia

• Gene Location: Start: 45059; End: 47605 Strand: -

Full Sequence      

MEISLNGKWQFRECNTDKYYPATVPGCNFLDLIDNKIIEDPFIGLNEKDADFVGKKDWEY
KRTFTLDEEQLGSDDIILSCKMLDTVCDIFINGEKIGSADNCFIKHEFPVKDYLKNGENE
IKIVFYSPVNYVEKIYKKESAPPNSNGQNGIVHIRKPQSHFGWDWGPVLPPSGISDDISL
VFINGARITYLSAKQVHSDGRVTVKLSTETEKYADNIECELSVISPDGTVLKKDGESADF
IIENPELWQTYELSRKEKQPLYTVKAVLKKDGKAVDTYEKKIGLRTLYLDRSRDEYGSNF
KFVLNGVPLFIKGSNYIPPDSFITRFDEKQLEKMLNAVRFSNMNMLRIWGGGFYESDEFY
SKCDEMGILLWQDFQFACQAYPFFKESFLENVKKEIKYNVKRLCDHPSLALWCGNNEIEE
MHNGWMLMKDYVAWTEKFFYEILEPELRKYDPDTSYIPGSPCGVSHNKGVDCDNVGDTHL
WAVWHGLKPMTFYRKRMTRFCSEFGFESLPDIKTVRKFAGDGELSLSSKVFLSHQKCLNG
NDKMIYYIASRFYLPKKFEDYIYLSQITQSECIEDATEHWRRNRGRCNGAMYWQFNDCWP
VCSWASYDYYGNYKALQYCARNFNAPLTVSAEDSKDGVKLFVLNDFDGEKAVRVEYSVFD
FNKEVVVCSGEKTLRVPALSSTLAFDLKNSDLLKGSGKHSAVMRIKLFENGILTADRTLL
FDKEKKIHLPSAKIEMQISEVPSGLEIKLKSDRYSRLVKLESSISQEPFSDNFFDLFPNE
EKTVMINKDNRFSLAELKESLSVMSLCDVERDGNPVTAIKNKIKVLTSPVNIGNAVWHGR
IQKDIDLA

Enzyme Prediction     

No EC number prediction in MGYG000000726_01353.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	707	1.9e-103	0.7180851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.55e-98	1	774	11	773	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	5.24e-18	732	808	2	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	1.62e-12	5	417	44	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	6.23e-11	181	285	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	1.50e-08	203	417	201	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98156.1	4.33e-212	1	817	2	832
AUG59052.1	5.69e-191	1	808	1	816
QGH33887.1	3.15e-189	1	806	2	812
QEH70285.1	5.79e-188	3	809	4	821
ADZ84812.1	1.63e-187	3	809	4	821

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.23e-153	5	786	11	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.30e-153	5	786	13	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.34e-153	5	786	13	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.52e-153	5	786	11	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.46e-151	5	786	11	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q29444	4.58e-114	1	808	21	877	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	6.62e-113	1	808	21	877	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
I2C092	3.63e-103	3	787	7	839	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
O00462	3.16e-102	1	809	21	878	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q5B7W2	2.14e-99	5	786	9	826	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000726_01353.