CAZyme Information: MGYG000000728_01493

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212
• CAZyme ID: MGYG000000728_01493
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705		80284.36	4.7173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000728	1947591	MAG	Kazakhstan	Asia

• Gene Location: Start: 4993; End: 7110 Strand: -

Full Sequence      

MKKRAAFFTKILFCLLLVGIAAFCSASVYETWAASGTAEQWLSQELSFAASQKYEAPYYD
VNLDVVFTNSRTGTTFTVPGFWDGGAVWKVRFALTELGEWRYRTVCNNSSDTGLHDRQGT
ISCIAYTGDLPIYQRGFVSVQDRTRYFTYADGTPFFYLGDTHWHMLLEDLESRFPAILEE
RAKQGFTVIQSEPLGIWTNAYGNDGLTGVFEEFSEELLLQFQELDKYFEMIASYGFVHAN
SQFSYPTSLGAYMNKISDENLERLCRYWVARYSSYPVMWTTAQECDNDYYYERGDQSDFS
AETNPWKKVAEWIHRYDPYKSPLTAHQEHSSYTTASNSAFGEVEGHNWWASQFGFDIDSQ
FPFYQASNYWYYGKEKVIVNYEGRYDHFWTTTAGARAQGWTSYLNGMYGYGYGSAKIWSA
YDAPGIWGGAVPDKVSDSYETLYRSDMDITWQESLQLPAAAQLGYMKAFLEEQQWWLLKP
QFESASRFLPAGSDVYYSVARKDYDRIVAYFYSRTRSTGTFKKLNETYYKVSWFNPCTGE
YLSDPELRFAKAGILELGEKPDSYDWVALLEKAENALEFQTGANCYIDGSYLYIPGARTG
EQLFDLIKDTSALSLSGTKGDFVGTGGTLTCHDTDYTIVVKGDVNGDGRITSSDYIRIKK
YIGGTAQLTGASFLAADIDSNNTIKSADYIKIKAHFAGRIDIWKI

Enzyme Prediction     

No EC number prediction in MGYG000000728_01493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	137	547	5.9e-42	0.9538834951456311

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.89e-43	145	471	3	318	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam16586	DUF5060	8.63e-22	37	107	1	70	Domain of unknown function (DUF5060). This is the N-terminal domain of a putative glycoside hydrolase, DUF4038. It is found in a number of different bacterial orders.
cd14256	Dockerin_I	2.58e-16	641	695	1	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	3.93e-11	642	696	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14253	Dockerin	3.49e-06	642	697	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCW44877.1	1.60e-130	54	573	98	593
BBI36498.1	6.06e-102	16	630	14	615
QJD82871.1	5.30e-94	39	572	41	569
QTH45264.1	1.47e-92	17	572	15	569
QNK56434.1	2.62e-92	30	617	29	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4N0R_A	8.27e-10	39	332	6	293	ChainA, putative glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],4N0R_B Chain B, putative glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.159164	0.720212	0.119008	0.000542	0.000401	0.000637

TMHMM  Annotations     

start	end
7	29