CAZyme Information: MGYG000000729_01342

Basic Information

• Species: F23-B02 sp900545805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp900545805
• CAZyme ID: MGYG000000729_01342
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		66056.82	6.4243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000729	1856951	MAG	Kazakhstan	Asia

• Gene Location: Start: 35298; End: 37046 Strand: +

Full Sequence      

MRLTYVFPILILLFIGLFFFGCPSPASATLEDRPKSAFRRRDAIALGIITLVYAVAAFAG
LGDTDAPQSFHEFKSGESVTVDLGQVRDIDSITIYSGLNTGSYRIEASDDGESWFDLTSF
EQNYVALFKWNDVELDELQLGAARYLRLTAAGEVWLGEMAVRCGGELVGSSSDAPELFDE
QDTVPEYQHYTNSTYFDEIYHARTAFENLEGVYPYEISHPPLGKLIIAIGISLFGMTPFG
WRFSGALIGVLMLPVMYMLLKRMFASTRICACATAIFAFDFMHFAQTRIATIDSYAVFFI
LLMYLFMYMYITEGRWRDLALSGLLFGIGAACKWTCFYAGAGLAVIWLMHWIRNFELKAF
LKNCAFCVVFFIIVPAMIYYVSYFPYGRASGMHSLGMLFTSDYAGMVLDNQKFMFSYHAG
VHSEHPYSSRWWQWVIDERPILYYLKYFDDGTRSSFGAFLNPVLCWGGLAAMIVCAVLAV
KRRDRVSLFIVIGYLAQLLPWVFITRTTFEYHYFPSSVFLVLAIARVFRLMKDNTKDWKF
NVYGLTGLAGALFIAFYPVISGVRVNAQLATNLLKWLPSWPF

Enzyme Prediction     

No EC number prediction in MGYG000000729_01342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	190	385	1.8e-55	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.16e-20	411	562	7	183	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	5.10e-20	192	383	46	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	4.49e-18	192	385	19	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.53e-15	218	353	1	135	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4346	COG4346	1.59e-13	207	445	126	331	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	1.52e-171	40	582	63	653
QQR07704.1	1.52e-171	40	582	63	653
QIA32159.1	4.86e-169	40	582	59	649
QBB67038.1	9.56e-158	34	582	68	752
ALP95330.1	1.91e-157	34	582	68	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	3.88e-25	196	580	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	3.88e-25	196	580	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	2.15e-24	196	580	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	2.91e-17	217	580	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.023850	0.002900	0.973157	0.000018	0.000014	0.000051

TMHMM  Annotations     

start	end
5	22
43	62
238	260
289	311
326	348
360	382
458	480
487	504
509	528
541	563