CAZyme Information: MGYG000000729_01691

Basic Information

• Species: F23-B02 sp900545805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp900545805
• CAZyme ID: MGYG000000729_01691
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000000729_19|CGC1	41450.8	5.4091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000729	1856951	MAG	Kazakhstan	Asia

• Gene Location: Start: 5411; End: 6541 Strand: +

Full Sequence      

MRIYIARRGDSLYSIARANGVTVRTLAELNELSDPARLSVGQAIVIPDMSRPVSETEVNG
YAYPNISAQQLGAVLPQLTYLCPFSWQIDETGGITPIDDEGMISAAWENGCAPLLTLTNL
GVNGGFSSGIAHSIFTDAAAQDTLVRNTLSVLESRGYYGVNLNIEYVQPYDREGYNAFLK
RMSETLHSSGYMLSSAVAPKSADDQHGVLYTAHDYAFHGQYCDRVVIMTYEWGYTYSAPR
AISPVNEMRRVIAYAVTKMPPSKILLGFSNYGYDWTLPWKQGQAARVISNAAAVNLAASV
YAQIKLDETAQAPFFNYTDPAGARHEVWFEDARSVRARLALVREYGLAGISIWTVNMRNR
AGLSVLESEFSTEKIV

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	124	359	1.5e-39	0.7297297297297297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.04e-131	56	359	2	306	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.20e-105	2	371	50	423	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	2.06e-37	61	353	7	288	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	7.59e-35	75	357	23	333	Glyco_18 domain.
pfam00704	Glyco_hydro_18	3.44e-27	122	357	70	306	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS98543.1	2.28e-120	32	375	82	425
CDZ24826.1	1.84e-119	1	376	1	426
ABK60508.1	2.44e-117	2	376	31	405
QGU95872.1	1.51e-115	1	376	1	425
QNU67347.1	1.51e-115	1	375	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	1.05e-71	1	374	3	429	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	3.17e-71	2	376	5	433	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	2.49e-58	64	357	19	310	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	3.19e-27	117	361	67	305	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	1.27e-24	124	368	81	337	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	3.34e-76	1	374	1	427	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	2.94e-70	1	374	2	428	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.63e-69	1	374	2	428	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	2.76e-64	3	375	49	420	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	8.32e-29	126	355	101	328	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000729_01691.