CAZyme Information: MGYG000000729_01735

Basic Information

• Species: F23-B02 sp900545805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp900545805
• CAZyme ID: MGYG000000729_01735
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		58294.29	4.7399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000729	1856951	MAG	Kazakhstan	Asia

• Gene Location: Start: 5461; End: 7065 Strand: +

Full Sequence      

MKRYISFLLAVLMLVTLVPTAALADNETEEMKASDNLKTLIKYWEGVKLKAYKAHASEEY
WTIGYGHYGPDVYEGMEITAEQADAYFEQDIAQFEAAARRINEKYGLNANQNQFDALVSL
AYNFGPGWVEANTGWRLARYIKSNFRDSYGNPIPDLEIADAFAVLCSAGGEILPGLVKRR
INEAEIFLYGSYNTALTNFVVVIIDANGGTADGNRVVAYNKDKPYGSLPTASRQGFSLDY
WKDSDTGSVLTGSTIADKSRYITAVWSGGIAPETYKLTVSGGEGSGSYTEGTKVKLVPAV
SSGKAFVRWDVTGAGAVLGGDGYYYITMPASDVTAVAVWRSVCPLGDKCPTKDFTDNPVT
YWAHNDIDSVIALRLFKGTSGTTFGPDIVMSRCMLITVLYRLEGSPDVTGYENRFTDVDA
DGYYYNALLWGSHNNISNGYSDGRFAPDDPLTREQLVTFLHRYANYKGYNTDVYTDIGGY
SDAAKVSPFARESMCWAIGAGIVNGTGNNTLSPQDSALRAQVAAMFNRFAGGMA

Enzyme Prediction     

No EC number prediction in MGYG000000729_01735.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	34	183	1.4e-31	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	2.06e-44	40	188	4	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.80e-26	31	192	5	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	1.12e-17	39	188	10	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	2.73e-17	60	155	1	99	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
cd16901	lyz_P1	2.79e-17	40	183	9	135	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE59829.1	1.75e-42	202	529	618	960
QQR06511.1	1.75e-42	202	529	618	960
QCI60723.1	9.31e-35	297	528	331	565
QRV19850.1	1.09e-34	345	529	447	630
ADL06029.1	1.13e-34	345	529	456	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	7.32e-18	34	188	53	194	ChainA, Lysozyme [Acinetobacter baumannii]
7M5I_A	3.34e-14	41	192	17	158	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
2ANV_A	1.39e-08	31	188	2	145	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6H9D_A	6.88e-08	40	188	13	147	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37896	7.38e-22	40	190	10	145	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P07540	9.08e-20	40	191	10	146	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	9.08e-20	40	191	10	146	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
C6CRV0	9.99e-19	354	528	1283	1457	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P62692	5.52e-17	31	187	1	136	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.998930	0.000204	0.000199	0.000185	0.000181

TMHMM  Annotations     

start	end
5	24