CAZyme Information: MGYG000000730_00045

Basic Information

• Species: Phil1 sp001940855
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; Phil1; Phil1 sp001940855
• CAZyme ID: MGYG000000730_00045
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1881		206879.97	4.5897

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000730	2096902	MAG	Kazakhstan	Asia

• Gene Location: Start: 53690; End: 59335 Strand: -

Full Sequence      

MRNQVFKKLFSVLLALIMVAGLLPASVLAEGEGNADSTPAPTEAVQPTESAEPTAPTETE
TPEVTEVPEPTPENPAATVEPTQGEPTAEPTDEGIMPANVMPVQANVELQYRIVHLDCGR
EYFTKDWIIALINEMADAGYNQLQLAFGNGGFRFYLNDMAIGSHSSDEVKNALEAGNAHY
NTYGDDENGPNNQEWITYNPSKNALTETEMNAIIAHAQSKGIEIVPMLNTPGHMHAVLAA
MSKLGISGNLQVSGKPGCLNLENTVAVSFTKELVSKYVKYFADNGCNFFNAAMDEYSSWE
NVFYNYANEIISIITKYNMTPRMFNDALRRNNTISNSNVQVCYWFYGNNCYPVDDITQYQ
LINANHDYYYVSTNENWNLYREGYTFVGEYNEDTWINKAKQFNNNTFNYGSGVGTTVNNP
VGSMFCIWCNTPGKNTETQIAQQIRMILRVIGARMQNSDIYSASNELVEGGFKADGTINV
PTNNKTVGNGSGNTTADNDTVRVTGPNLAALKCETTTVTIQGAAEGKIAAYDVTPSTADN
NKYIGEAEVRIKIPEGWDKTKVKAFIVEDGTAKDIDGTATEDGWYVFTAPHFSVMGIYEK
AATTEVGGTIEITKGSTGVITVPGDVTNSVGEIADKTVAEKVEVKPVQQTGETISYSATA
STDAGVNGNYVVSNLIDGELNTKYYSGGSQKVGQHVQIDIGAAIQFDTVLVSTPSDSNMN
GNTSDYCTNANVMVSVDGENWTTLGQYTGSSNNKTQTYTNSLEKVRYIRVQITTAKNNWW
QLAEIQWGSYANGKFTRMAASGSVTTEGKTETQVTIKGIAGGETTIKIDGKTYTIKVVDA
TLAQQVLPINLWITNTGVVPTGWSNSAPAEFSYDDTAGNRRSIYTLKASHSTVNSPNGIS
LSSILPQVTGTAKSWDNNTYNVTYWKSAYHTAENRQSTDGWTNYSHKGTKFEYIRFYEGS
WAYSVDGITWVNIENVGAGATDTDKNQVCIWYRQVTTVTSEVTTEIVDWGPIKYGANQCL
LDFAVKYDGTSDRIPNSFPATGKTIGFDCPTNQAVPLGNGYVVKDTDSTYYRTVYGIAGV
ETAAYEVYMITLTPSSDSHTAYINNGSTQANYKYKGTEKIAWAKTEADANSTELNKMPNV
KYGGEPFLESVKIYQYQGLLVTYYLRAKQTPDSLTVHYAIQGSETAFYEYNIAVNQGTTF
DSGIALDHSQDPYVGGPLLNGRVTNSNGETITVSSNLATLQGLEPQYRYSKYEIVGFRKD
DKNVWIYYTFTREHTYVIDFGLPLKIKFSDFGVTNDEAIGTVSLWEKETVLENKGLYGTA
KVIMNDTEGKYVLYTLDKPLDKNITIPLYVKFSQKGDNDKPQLFTANIIPATNVYYEDSF
AKFTNGSYNGGAIAWEDAGTKPQETPTQALEALGNKTNVYGYDPAYQNSTMFSMGSAQKV
TVTSTMATTGVVWPTAQFTFKGTGFDIISLTDNTSGAIFVDVVNAKTGVKAKSLFVNNYY
GYKYNEATQTWETVQTGNNALYQIPVIAVRDLGYDEYNVVISVAYNTFFDKTTKQEYSFW
LDAVRVYDPMGESVNTGETYKPDGEAYPQYIKLRSELKKLNGDGTASSGALFIDGKENAN
ISEYANYGPNNEVYLAKGQAITFKLVGENLSKIATVQIGAKSPNSSAEKTATMKVGADVK
QEILGTATEMYYDISAVKDGRIVTITNTGEAILSLTNLKITYTEGNQTVSLGEVSAEQQT
QAVQMVRALFAPAPVEPEPEPEPEKTFEPERFEASWSRNVMQGRKATLTVKTSEDVEAIT
VDGQTIRSYRTRTERVGFGRRAKRITYREFTYSMVAQESADFSVTAINAEGTESEAITAR
LTVKTRPNSLRDMWDWFKGWF

Enzyme Prediction     

No EC number prediction in MGYG000000730_00045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	110	444	7e-40	0.913946587537092
CBM32	659	787	1.5e-18	0.9516129032258065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06564	GH20_DspB_LnbB-like	1.71e-56	111	455	2	323	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06565	GH20_GcnA-like	1.71e-18	111	401	1	265	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd02742	GH20_hexosaminidase	1.10e-17	111	373	1	242	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
pfam00754	F5_F8_type_C	3.08e-13	657	780	1	120	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd06563	GH20_chitobiase-like	1.17e-09	111	248	3	126	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP95510.1	8.64e-154	8	1721	11	1685
QBB67228.1	6.23e-140	8	1740	11	1712
QMW75670.1	1.37e-42	103	437	29	365
QPS13996.1	1.37e-42	103	437	29	365
QQY27185.1	1.37e-42	103	437	29	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7PUL_A	3.23e-35	113	437	12	331	ChainA, Beta-N-acetylhexosaminidase [Enterococcus faecalis]
4AZ7_A	8.53e-35	112	432	8	341	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
2YL6_A	8.69e-35	112	432	8	341	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],4AZ5_A Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
4AZ6_A	8.85e-35	112	432	10	343	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
2YLL_A	1.24e-34	112	432	28	361	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49610	4.79e-32	112	432	188	521	Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=strH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000625	0.998190	0.000520	0.000219	0.000215	0.000183

TMHMM  Annotations     

start	end
9	28