CAZyme Information: MGYG000000730_01646

Basic Information

• Species: Phil1 sp001940855
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; Phil1; Phil1 sp001940855
• CAZyme ID: MGYG000000730_01646
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000000730_14|CGC1	29026.07	10.1826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000730	2096902	MAG	Kazakhstan	Asia

• Gene Location: Start: 20891; End: 21697 Strand: -

Full Sequence      

MRILQRGDTGSDVRTAQTALIRAGYDPGAANGVFGAATERAVMQFQRVLGATQDGIIGPV
TWQFLEPFALESDPDVLRRGSRGAMVRRLQEALEASGNSPGRIDGLFGTKTQAALRAFQR
SAMLAQTGVADRATWLAIAPYIDYGDVYLRRGDRGMLVTILQTALTSAGFSPGQADGIFG
SRTFNAVTAFQRANRITADGIAGPRTWALLKPYLSGELMTYVVRRGDTLSSIARRFNTTV
EELLRLNPREDPDLIFVGETLLIPVSKG

Enzyme Prediction     

No EC number prediction in MGYG000000730_01646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	221	264	8.8e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3409	PGRP	6.71e-20	74	210	36	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.52e-19	1	139	36	184	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
cd00118	LysM	4.36e-17	220	263	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01471	PG_binding_1	2.61e-16	9	65	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
smart00257	LysM	1.33e-15	220	263	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGA69465.1	1.81e-45	4	210	156	375
AFM00719.1	3.19e-44	3	210	75	295
ACL20957.1	6.79e-44	3	210	87	305
CDX01843.1	3.61e-43	3	210	81	304
BAE83569.1	4.81e-43	3	210	95	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BKH_A	1.21e-12	149	210	12	73	ChainA, lytic transglycosylase [Pseudomonas phage phiKZ],3BKV_A Chain A, lytic transglycosylase [Pseudomonas phage phiKZ]
5NM7_A	1.90e-09	149	210	5	65	Crystalstructure of Burkholderia AP3 phage endolysin [Burkholderia],5NM7_G Crystal structure of Burkholderia AP3 phage endolysin [Burkholderia]
5TV7_A	6.20e-09	149	207	109	166	ChainA, Putative peptidoglycan-binding/hydrolysing protein [Clostridioides difficile 630],5TV7_B Chain B, Putative peptidoglycan-binding/hydrolysing protein [Clostridioides difficile 630]
7RUM_A	6.23e-07	149	211	25	86	ChainA, Endolysin [Salmonella phage GEC_vB_GOT],7RUM_B Chain B, Endolysin [Salmonella phage GEC_vB_GOT]
4UZ2_A	1.08e-06	220	264	4	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36550	1.60e-08	71	214	190	359	N-acetylmuramoyl-L-alanine amidase CwlL OS=Bacillus licheniformis OX=1402 GN=cwlL PE=3 SV=1
O31447	2.29e-08	17	210	85	277	Uncharacterized protein YbfG OS=Bacillus subtilis (strain 168) OX=224308 GN=ybfG PE=3 SV=1
P39800	5.63e-08	175	268	98	208	N-acetylmuramoyl-L-alanine amidase XlyA OS=Bacillus subtilis (strain 168) OX=224308 GN=xlyA PE=1 SV=1
Q99125	6.89e-08	76	208	194	347	Probable N-acetylmuramoyl-L-alanine amidase OS=Bacillus licheniformis OX=1402 PE=3 SV=1
O34320	5.29e-07	13	210	81	277	Uncharacterized protein FadG OS=Bacillus subtilis (strain 168) OX=224308 GN=fadG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998971	0.001041	0.000031	0.000003	0.000002	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000730_01646.