CAZyme Information: MGYG000000730_01753

Basic Information

• Species: Phil1 sp001940855
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; Phil1; Phil1 sp001940855
• CAZyme ID: MGYG000000730_01753
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	MGYG000000730_16|CGC1	25088.26	9.9492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000730	2096902	MAG	Kazakhstan	Asia

• Gene Location: Start: 33441; End: 34127 Strand: -

Full Sequence      

MSAAQSAKRTQPGKAYAKKTSRQSAAKRSKKAKAVKKASTRRIIIALVGIAAIIMLTIGG
FMANRMLERRTYKLIYADEILACADEFSLDPCLVAAVIHTESSNRAAVVSPKGAIGLMQI
MPSTGEWIAGKLGMADYSEEKLMEPLINIRLGCWYLRYLSDKYGGMERTALSAYNAGPGN
ADKWLNDPAYGDGKRLISIPYVETAAYADKVLSAKEKYRELYEKELCK

Enzyme Prediction     

No EC number prediction in MGYG000000730_01753.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	91	218	5.3e-28	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.34e-73	76	217	4	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.27e-45	72	221	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.34e-36	91	214	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.76e-29	72	224	135	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	1.12e-24	80	216	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	3.83e-51	61	223	34	195
QWT54455.1	3.02e-45	43	222	29	206
AAM24132.1	1.85e-43	69	224	28	184
ADV80073.1	3.81e-43	69	223	28	183
ABY95122.1	5.92e-43	69	223	43	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	7.46e-19	62	222	394	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	7.48e-19	62	222	398	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	7.52e-19	62	222	404	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	7.54e-19	62	222	408	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	7.57e-19	62	222	414	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	6.61e-19	80	213	64	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.06e-17	57	219	463	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	8.96e-17	57	219	463	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	8.96e-17	57	219	463	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O64046	2.73e-16	71	217	1417	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999770	0.000234	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
43	62