CAZyme Information: MGYG000000731_00885

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000731_00885
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		29178.03	6.3825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000731	1796272	MAG	Kazakhstan	Asia

• Gene Location: Start: 990; End: 1790 Strand: +

Full Sequence      

MDQTQTGDDAPLLTHSTPQSEQTALLAQQKPLVTIVHASVGSGHKAAANAIAQAFDLIRG
TNGIPEDVEIEVLDILDFGRIKFDGNKTAASFTGATRPIYDLTWRYTLTGHLLWGGGTAW
SRIMFPAFNEYVRSRRPIAVVATHITAANVAVGARVITGIDYPVICVPTDYEVEGWWPHK
DTDLFCVANEFMAETLRPRKVSEAKIRITGIPIRAGFDTDYNREEELQKFNLPVDNCAGN
GRRQLASTVRPLSRGDGPHTPLPAQL

Enzyme Prediction     

No EC number prediction in MGYG000000731_00885.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	4.38e-20	33	262	1	229	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	7.21e-09	158	232	124	198	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	1.95e-05	160	232	126	198	diacylglycerol glucosyltransferase; Provisional
pfam06925	MGDG_synth	1.46e-04	113	213	52	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53616.1	3.51e-163	1	235	1	235
AZH69564.1	1.16e-161	1	235	1	235
QIA34715.1	9.47e-146	16	235	3	222
QWT17007.1	1.89e-110	31	235	16	220
AEB07075.1	3.92e-104	30	235	35	240

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000731_00885.