CAZyme Information: MGYG000000734_00414

Basic Information

• Species: UBA10281 sp900548285
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900548285
• CAZyme ID: MGYG000000734_00414
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634		72372.35	5.8032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000734	2140620	MAG	Kazakhstan	Asia

• Gene Location: Start: 79598; End: 81502 Strand: -

Full Sequence      

MSAELLQGTKIWLGDVNAVDSYVDFKGVFSMGGKGKRGKKVLLRISCDSNYSVYINGKLV
GFAQCADYPHYRNYDEIDVTGFCRKDKNVFTATVWHYGVDSQTYVNADAYLLFDIVCDGE
TLLKSDETIGARVNARYLNGYAKTITPQLGISFLYNANEKCGGFESSEEHGFGEAHKRER
GICKMKARGAKAEVKKTKGGYLVDFKKETVGFLTFDFKSETEQKITVSYGERLLPDGNVQ
RFLEGRDFSAEYVAKKGENRYVNTFRRIAGRYLFVETENPIDWGYIGVREVYYPIDEIRR
KFADPLLQKIYDVSVYTVRCCMHEHYEDCPWREQAFYAMDSRNQMLCNYYTYKKTIYQRE
NLVLMSKGLREDGLLSLCFPAGVDYPIPFFSLAYIMQTYEYVKYTGDKTLLDETGETLDK
IMSVFLSRIDDNRLIAQLPAPYWNFYEWAEDSANDDQLSKAPRDHLPKVYDLTLNCMFIY
AAKMYNELRGKNIETDGMKKAVRETLYVPGKDAFRFSNLSEKMSVLGNSLAVLADVGDEK
TVDAIVRGDGMIPVTLSMNAFKYDSLLLFGDKYKQYIIDDIKTKYKKMLDDGATTFWETE
LGADDFGGAGSLCHGWSAIPIYYLSVLAENKIVG

Enzyme Prediction     

No EC number prediction in MGYG000000734_00414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	196	624	2e-59	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.52e-12	304	624	10	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	9.70e-06	195	276	1	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	5.18e-111	11	631	14	713
QGQ97405.1	6.31e-79	19	632	21	720
QNK57365.1	3.16e-78	11	623	8	708
AQQ71631.1	1.73e-72	11	634	13	694
ARN56684.1	1.95e-72	11	623	26	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.37e-27	202	631	440	881	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	2.27e-13	192	624	185	632	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000734_00414.