CAZyme Information: MGYG000000734_00728

Basic Information

• Species: UBA10281 sp900548285
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900548285
• CAZyme ID: MGYG000000734_00728
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827	MGYG000000734_7|CGC1	92487.01	5.0013

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000734	2140620	MAG	Kazakhstan	Asia

• Gene Location: Start: 56269; End: 58752 Strand: -

Full Sequence      

MIKLSDVLVDRSKTPFAVRRNKPSVIWRATGENQAAYRIGVAKSCYKAINGQFDVYDSGV
NESGETIGHAVGAELEPCTTYYVSVTIYGENGGEDSAVVRFRTELSAEDWKGYWTFMPLN
SVGGSSLYRKNIVLPDEPVEEAFAYCAGIGCHELFVNGKKADDRLFSPVNSDYEKRIYYT
VYELTGRLVAGENVIGVELAPWWYGGKKLLFQLYVTLKNGETLEFHSSAGDGWWERGGAV
KECSVYDGEFCDGRVEDEFLPHWASADYRAGIESKWVLPIVSRGDSSILAPERIDPIRVC
GRLTPVASHKANGGVIYDFGANIAGRLSVTVCGERGAEITLVHAERLTADGDVNTLNLRS
ARATDRYVLKGEKTCETYSPRFTYHGFQFAKIITKGNVTVKSVVAERLHSDVDLIGEFSC
SDEKLNYLHEIAVRTEQNNQFGVLTDCPQRDERFGWLNDLGARLYQTVYNFDMSRFFPKV
VADISDGQLPGGEIGDTAPYYVGGRPADPVSVAYLLMPYYSYVYYGDDSVAKREYSNLKR
WVDYLLSRTENGIVTYSYYGDWVFPTCFGKSADKLFVSTISLYWHLLVMIKIAKIVGEKS
DEKYYAERSEEVKNAINAKYYDSAKKSYACGAQTENSMSLTLNVAPERDRAAIAENVAKD
VIAKNYHSTCGNVGYRHLFYVLGEFGYQDLAVKILENPEYPGWGYMVANGATSVWERWES
EMSDEMDSFDHPMFGSYDAFFYAFLGGITVDDDAFACDKITIAPVKPSGMTYVNCSLNTI
RGKVVSNWKEDGETTVYHVEIPFGTTACFKAEGVEKTLTHGVYNIKI

Enzyme Prediction     

No EC number prediction in MGYG000000734_00728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	309	807	7.5e-139	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.37e-96	416	743	4	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	4.11e-26	310	392	2	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.13e-25	138	299	2	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	8.55e-07	759	807	11	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC51112.1	4.74e-168	2	821	69	907
QGA22854.1	1.03e-167	2	807	32	847
VEH16339.1	1.29e-157	23	827	52	870
AHF90970.1	8.92e-148	105	807	120	840
AEF82974.1	7.75e-141	22	805	30	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	4.97e-138	6	802	34	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.51e-80	129	807	306	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.01e-70	2	793	2	821	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3CIH_A	5.04e-11	305	723	183	604	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.10e-84	7	807	35	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.18e-79	129	807	306	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.90e-78	13	807	45	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	8.51e-74	109	809	145	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000734_00728.