CAZyme Information: MGYG000000736_01428

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110
• CAZyme ID: MGYG000000736_01428
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
903	MGYG000000736_35|CGC1	100315.58	4.4741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000736	1883440	MAG	Kazakhstan	Asia

• Gene Location: Start: 8505; End: 11216 Strand: +

Full Sequence      

MAKKKKNEKNTVTPARKAFRCIGKVLLVLLKVLGTLLLIGAVTGSIVAVKLSGYLKESVI
PGAESYAEVLDLDQVTLSQTSIIYCYNKNTQQYEELQQLDATENRIWVSYDKIPKNMIWA
VVSIEDKRFFEHDGVDWITTGKACLKMFMGTGSAGGSTITQQLIKNLTHEDDVTVHRKIN
EIFRALAVEKKYSKEEILEWYLNTVYFGEGCWGVQSAAQVYFGKDVSELTAAECACIAGI
TNNPSLYDPYIRPERNRSRQLLILQQMLEQGHIEQAEYDEAVAQEMVFRNGSTDEDTYRC
EACGFEGTLSDFVEQDDGYDCPECGARTDIEKRSEHYSYFVDRVYRDVVNDLMEEYGLTE
KAAIQKLLTGGYHIYATIDLDVQKAVDEVYLDVDNAPEVKSEQQLQSAIVVIDNETGDIV
ALAGGLGEKSGSLSLDRSSQSLRSPGSSFKPVSVYGPAFDQGLISPITVYDDTPFSFDNG
PYPKNETRRYQGLVNINKAVNESLNTIAMKVLDDLGVDASYDYLTEKFGFTTLIEDKEIN
GKAYSDIGYAPLALGALTKGVTVREMAQAFATYPNNGEFREARTYTKVVDSEGKTILGNV
QETHTAVSEKAAYYVNYVLQNVVEYGTGTPAKIADMAVAGKTGTSSSNVDRYFVGYTPYY
TAAVWSGFDQPEQIVLTGETRTNPSTRLWRRVMVKLHDGKESASFDRPDDIVSCTVCRDS
GLLATSECKNDARGDRSQTLLVAREDVPTKSCNLHIRVDVCKESGMIANEFCAKMHGNEI
ESKSILCFLRAFPTGGIVVEDQQYVYWDGELPNGKYFAAVSSSIAHPANEVCTLHTQQTV
DEQEDPTEPTEPSDEPKPVDPTEPTEPTEPTEPTPEPTQSPEAIVPTESFLQWWKKKMME
LGA

Enzyme Prediction     

No EC number prediction in MGYG000000736_01428.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	95	267	1.4e-65	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	2.10e-177	104	697	1	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.64e-161	67	709	42	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.64e-128	41	730	12	752	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.29e-78	103	268	11	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	2.29e-75	105	780	58	634	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP94484.1	8.82e-200	31	804	35	787
QBB65500.1	1.86e-199	31	804	3	755
BAK99350.1	8.89e-192	32	805	33	779
QNL43378.1	1.81e-191	31	836	28	777
QIA31344.1	4.08e-191	31	806	32	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	3.49e-73	79	725	19	790	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	2.60e-69	188	673	3	437	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.63e-64	188	673	3	437	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
4OON_A	1.33e-56	108	716	42	742	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	3.00e-55	86	711	11	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TNZ8	1.97e-97	70	760	60	729	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
A7FY32	2.74e-97	67	805	42	746	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	2.74e-97	67	805	42	746	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7GHV1	4.96e-97	67	805	42	746	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0SRL7	8.22e-96	39	755	33	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999977	0.000049	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
25	47