CAZyme Information: MGYG000000738_00576

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000000738_00576
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		85332.02	6.5174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000738	934493	MAG	Kazakhstan	Asia

• Gene Location: Start: 35; End: 2374 Strand: +

Full Sequence      

MISIIIIGIILGISANTWKTMATDMAKNESSTVVDKDGSTIAKIGDQRKKSNLTSSEMPQ
KLKDAYVAIEDERFYKHGGVDIKRTTSAIFSYIIHFGSSSFGGSTITQQLVKNLTGDTTD
SITRKVNEWWKATILETAMSKDEILTSYLNIIYIGPSIYGVENGAHYYFNKSANNLSIAE
CAFLAGINHSPNSYNPFGDKDTSEKIANRTKTVLDKMKELKYITNDEYDNAITEVTNGLN
FKNGEVTAKSDGVYSYHTDALISELIGDIEKKYNISETFATNYTNMAGLTIKSTQNSKIQ
EEVEKESAKKKYILKSQNGKDTSQAAMVVMDHKTGQVLACSGGLGEKTEVRPFNRATQTV
RQTGSAIKPIAVLIPGIDKKDFTASTIFDDTEQDFDGSYHPVDYSKSLGNITVRRAVESS
QNIPFVEMMEKIKPSTSIKYMEKMGVTTLTKNDNGLPLALGGLEKGISPLQMAGAYATIA
NDGEYIEPVFYTQVLKSSGAKFVEAKQTKKRVFSKEVAYIVKELLTQPVQGASGTATYCK
INGVDVAAKTGTTDENYDRWLCGFTPYYTAVTWFGYDQNETVNFNQRNPAGLIWANVMSR
IHSGLQTAKFEKPAGVTTATICAETGLKATTGCESTYTEYFLWLTTPGLCSKHSGSEIKT
TNTTNNNNVTEIIKGITTDIDEKEPARTTEVTNTTNNSGATKNNNQTNINTNNNPHKSNT
NTLENNKSTTSSTTQNSTNSENSKGNTTNTTSNTNNSSSNKNTTNSSSTTNTINEDNEE

Enzyme Prediction     

No EC number prediction in MGYG000000738_00576.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	37	218	6.6e-60	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	1.07e-151	30	626	55	623	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.18e-147	57	604	9	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	3.28e-110	31	641	49	758	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.33e-73	56	633	153	712	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	3.93e-70	30	642	36	601	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV70266.1	8.36e-126	27	648	70	697
AEY67746.1	1.09e-121	33	660	79	729
ACL77170.1	1.09e-118	33	647	79	720
AUS97464.1	3.21e-118	8	658	51	738
ADU75447.1	1.82e-117	33	653	78	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	2.98e-73	29	647	19	807	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3DWK_A	2.17e-62	33	616	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.19e-57	33	616	19	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	5.77e-55	135	625	3	478	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	1.68e-49	135	625	3	478	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	1.69e-100	28	621	54	663	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.69e-100	28	621	54	663	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	3.07e-100	28	621	54	663	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0SRL7	4.20e-93	28	658	69	729	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q891X1	2.31e-91	28	655	58	715	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.780094	0.215385	0.002493	0.000349	0.000215	0.001459

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000738_00576.