CAZyme Information: MGYG000000740_00752

Basic Information

• Species: CAG-312 sp001917305
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp001917305
• CAZyme ID: MGYG000000740_00752
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	MGYG000000740_12|CGC1	62593.21	7.6028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000740	2359825	MAG	Kazakhstan	Asia

• Gene Location: Start: 6521; End: 8233 Strand: +

Full Sequence      

MKFSLFLLAVCAAFARAHADPKSYEEVFAPTIVGIPTADAVMGLCKMPDGKIRHYNYGGQ
PENAAGGGAFSLDVSNRMYIESSDGGFTWEKRQAAKGEEFGPFFHPESGRYFNFLNIGGS
AWFLDCGEDGKCARKSQICPWPLEFNAEPLVVGKRILMPVTLRTSSSQKSNDFVFGAIFL
ITDDFGKTWKKSGRLNVPHHKAGGTHMGTRWNHDAMEPSAVALKDGTLLCLLRTSLDNLW
QSRSKDGGMTWEKPTPTPFYGTCVMPKIGRLSDGRLLCMWSNATPLPEVRGADGVWEDVF
TNRNAIHAAISEDDGKTWRGFREVLLDSRRDAGDFADAYGADKSLHQSQFIEVAPGKILA
AVGQSGLHRKLVMFDAGWLLENSRECDFSNGLDDWSVFNYKKGARGHCAYNRIAGCSLED
NPDSAGKKCMLIKYEPDESLVSDIRGAVWNFPAARKGEIALKAKFNKGFKGAKIMLHDRW
INPSDEVAEPLALASIRLPESLGDGSVRDLRLKFDAGAKTARLFDGDKKIAEAEMGRPAP
VGISYLHIQSEKSPGDAGMLLLSVSEKGRP

Enzyme Prediction     

No EC number prediction in MGYG000000740_00752.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	66	320	3.5e-21	0.5380116959064327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.44e-21	73	333	40	306	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.91e-18	47	333	59	264	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.04e-08	183	374	53	228	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	1.96e-05	218	318	17	125	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX64725.1	1.78e-148	5	561	12	551
CEA17103.1	1.38e-147	4	561	9	550
QCQ56765.1	4.70e-145	18	561	22	556
QCQ52211.1	4.70e-145	18	561	22	556
QKH87412.1	4.70e-145	18	561	22	556

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000205	0.999199	0.000154	0.000146	0.000133	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000740_00752.