CAZyme Information: MGYG000000740_01422

Basic Information

• Species: CAG-312 sp001917305
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp001917305
• CAZyme ID: MGYG000000740_01422
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		50381.4	6.1121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000740	2359825	MAG	Kazakhstan	Asia

• Gene Location: Start: 895; End: 2202 Strand: -

Full Sequence      

MSAEGEKSDKIELRFGQELNPDGSVRHKLRANCDYREHFTLSGNGRDELRQFDYKSFRYA
EIIPPESGTAEVDESSIKLIARHMPFRIAAKNRYENDARARKVWDLCVRTLRYGAQEQIQ
DCMEREKGYYLGDGCYSMLAWCLLNGDFAPMRKFINDFLRTSFINGGLVTCANCSFMQEI
AEYPLMMFVLLPVLEERGDSREFVRERLGDFRKILDFYRENYAGDDGLLSNLDKWCVVEW
PSQWRDGYDVDIKEGEVCATKHNVINAWYVGAIRAFNKTARRLGEREYGGEAKLAEAFRN
AFYDPRKKLFKDSVESGRTSYPSNIYAWFLGLCPNEECRAEIIKMIRKKRLNKGMLFISF
PLLAGLQRDGEEELMLSLITDENTWMRMISEGATTTFEGWSKDAKWNTSLFHLTLSSCAA
FMVEGYNVGKVMDMR

Enzyme Prediction     

No EC number prediction in MGYG000000740_01422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	4	425	2.1e-58	0.8194444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.94e-13	198	422	115	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.52e-05	1	84	22	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43798.1	1.17e-169	3	433	316	742
BBH20286.1	1.27e-84	1	424	250	669
QCT01521.1	1.82e-84	2	426	247	670
AYQ75662.1	1.07e-79	1	424	226	645
VCV23259.1	1.91e-76	1	424	312	730

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000089	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000740_01422.