CAZyme Information: MGYG000000740_01425

Basic Information

• Species: CAG-312 sp001917305
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp001917305
• CAZyme ID: MGYG000000740_01425
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		71333.44	8.1541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000740	2359825	MAG	Kazakhstan	Asia

• Gene Location: Start: 3245; End: 5164 Strand: -

Full Sequence      

MYKSANYLLAIALAFQLAALQLFARSADAAPQSPAEVDTALGQMRISGDFAKNWNLSAKC
RTAEKGVQEITVSIESRRGESLPPQLCISWSIPQRGIQYRWHTSKGCGTIPADWGQPLYS
SLSGNSPILALMGNDGNNRLTFACSEAKRRVAFKAGVHEETNEIFCEIRLFSQRESPLKN
YSATIRLDTRGIPYCDAIGAAARWLGKLPGNNPLPVPETAREPFYSTWYSYHHNVFADEL
EKECELAAQYGMKGIILDGGWYADDGKRGCDFWGDGKASKLRFPDMRAHVENVHKLGMKY
MVWFGVPFIGYSSEAYGRFKGKYLNDMKNLDCASLDPRFPEVREYLIETCERILREWDID
GFKFDFIDMFRWNGEDPAIAENYAGRDIKNLPLAVDFLLSSMTERLSKIKKDLLIEFRQP
YIGPSIRKYGNMFRVMDCPGDALTNRLGTTNLRLASGTAAVHSDMLTWRADTPAEDAARQ
LLATLFAVPQISVRLEGLPPDHRKMLKFYLGFMAEHRDVLQNGKFLPLSPEQNYPQIRAE
KGDRAVIAVYGARQVADLPEGKICHVFNATAESALIVDSPSEFYAETFNVLGESVGKGRK
YPAGLSRIAVPISGCTKLKPIRSDDARKGSSASGMGGKY

Enzyme Prediction     

No EC number prediction in MGYG000000740_01425.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.94e-52	220	512	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	9.63e-11	221	366	1	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	1.60e-07	227	365	47	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG1501	YicI	2.38e-06	230	383	268	436	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
COG3345	GalA	2.65e-05	53	528	158	597	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	1.46e-199	41	619	7	586
AIQ58516.1	2.00e-153	83	623	48	595
AZN41080.1	3.10e-153	64	614	34	593
AIQ41463.1	6.15e-152	64	620	27	592
QJD86820.1	1.08e-151	65	620	29	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999173	0.000143	0.000159	0.000137	0.000127

TMHMM  Annotations     

start	end
7	24