CAZyme Information: MGYG000000742_01111

Basic Information

• Species: Dialister sp900541605
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900541605
• CAZyme ID: MGYG000000742_01111
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000000742_29|CGC1	38274.9	7.9736

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000742	2345274	MAG	Kazakhstan	Asia

• Gene Location: Start: 7339; End: 8322 Strand: +

Full Sequence      

MSNVLSHAITETIHFGRKPEEGDFHIALTGTADYIPHMGVVALTVHAHNRDMPICYHFFV
NHLEDVERKRLEKAAEIMDSPLEVHLIDDSAFRTLLLSDGVAAFFYRFLVAPAIAPVADR
VLYLDGDMMCRGSLKYLRDLDFQGNDVAVVSDRKEELQMKRVHTKRYFNAGMMLINVKQW
MEENRFDEIVHRAEENVKRVGNRLSHHDQDIHNEMLDGKCLYLEKRYNYLYNLDRQSLFK
KQPVNEDYKNQVIIHFAGHAKPWHSWVQDWPVVKEYAAIQKASPWKDVPLVEPKGRKNLH
QAARTARMRGKYGEMVKYYVRYFGEKI

Enzyme Prediction     

No EC number prediction in MGYG000000742_01111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	23	266	2.9e-44	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15171	PRK15171	3.34e-57	9	327	9	333	lipopolysaccharide 3-alpha-galactosyltransferase.
cd04194	GT8_A4GalT_like	4.89e-56	24	265	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	4.22e-46	25	266	1	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	3.34e-44	24	292	3	273	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	1.54e-17	40	264	18	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25792.1	3.40e-187	1	327	1	327
BBK25902.1	1.10e-81	17	326	19	336
QIB60889.1	5.72e-48	33	327	31	318
QWJ91714.1	5.31e-45	7	327	7	335
QQE93251.1	5.31e-45	7	327	7	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SS9_A	5.93e-15	26	264	3	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.09e-14	26	264	3	253	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
6U4B_A	3.09e-07	106	265	387	570	ChainA, WbbM protein [Klebsiella pneumoniae]
5GVV_A	3.29e-07	119	264	100	236	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVW_A	4.39e-07	119	264	100	236	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27128	5.56e-41	39	327	44	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19816	4.22e-39	14	327	18	335	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27129	3.74e-26	25	287	29	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19817	3.01e-22	33	289	35	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P25148	4.90e-17	25	288	8	279	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000742_01111.