CAZyme Information: MGYG000000742_01777

Basic Information

• Species: Dialister sp900541605
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900541605
• CAZyme ID: MGYG000000742_01777
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198	MGYG000000742_90|CGC1	22514.97	6.3446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000742	2345274	MAG	Kazakhstan	Asia

• Gene Location: Start: 3617; End: 4213 Strand: +

Full Sequence      

MRIALKRRKKEVQRHQGNTGAMVFTLLLAIFCVIFLFTVDNIKLLRPSEQVSHIIIQCAE
EENISPSLLEAVILTESKFDEKAVSHVGAVGMMQLMPDTAHWISEESGLPSDNLASPDQN
IPLGAWYLNYLLKKYHNNEVFALAAYNAGRGNVDEWIEKNKWPEGFTDMEKIPFPETREF
VKSVVIARDRLEAEKKGK

Enzyme Prediction     

No EC number prediction in MGYG000000742_01777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	61	185	5.3e-30	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.89e-71	54	184	7	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.25e-54	54	184	9	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.89e-43	66	184	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.54e-36	55	168	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.86e-31	45	184	133	276	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	4.59e-102	1	198	1	198
AOH39655.1	2.13e-63	17	194	13	189
CCC73618.1	3.35e-46	50	186	9	148
AVO73570.1	8.84e-46	50	186	41	180
AVO26251.1	8.84e-46	50	186	41	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.90e-22	55	185	420	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.91e-22	55	185	424	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.94e-22	55	185	430	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.95e-22	55	185	434	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.98e-22	55	185	440	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.27e-19	57	184	66	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	2.63e-18	62	185	491	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	4.16e-17	62	185	491	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	4.16e-17	62	185	491	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31976	5.69e-16	48	185	1419	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000028	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
20	39