CAZyme Information: MGYG000000743_00648

Basic Information

• Species: CAG-110 sp000434635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp000434635
• CAZyme ID: MGYG000000743_00648
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000000743_3|CGC2	57272	4.2278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000743	2477350	MAG	Kazakhstan	Asia

• Gene Location: Start: 173666; End: 175222 Strand: -

Full Sequence      

MMKKTEKLLALMLCAAMIAGFLGGCQKKPKRTTKETDETTYGIDVARYQGTIRWAEAAAS
GVDFAMVRVGMRGMAEGEISPDSNARYNLQEAEKNGVKLGVYFFSTAISKEEAVEEADWT
ADFIAQYPITYPVVYDCEGFTDMDSRQYGMSKAERTDIALAFLKRIEQRGYEGMFYAAKN
ELQDETLWETSRIEKHYKIWVAQFPGDADPAVHTSSYTGEHQMWQYTMEGSVPGISQPVD
MNVAYFGYDGVEKPKDETPPAEAFPDVEALMDFTEVNEEVTAKVETNLRDIPSQDTDSTV
LYTLKNGEIATRIAVSSSGWSKVTFNGNTYYAVTSYLTTDMNYSADAAGEAGEDGIKTVF
TPVNQEVTAKDVVNLRKLPSVEHEDAEVIAQLKNGDVATCVGVSDNGWSKLEYKGETCYA
VTSYLTPVDICGLPTQPEDDGIQTQFEEINDLVTAKVEVNLRSLPSVEDPDCVVVASLKN
GEVVTRTGINRDVGWSRVEYNGQTLYCVSSYLMAAQAQ

Enzyme Prediction     

No EC number prediction in MGYG000000743_00648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	43	235	2.1e-39	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.41e-63	42	245	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.85e-31	41	244	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.91e-23	43	235	1	180	Glycosyl hydrolases family 25.
cd06413	GH25_muramidase_1	2.45e-21	42	245	5	190	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06525	GH25_Lyc-like	2.99e-18	42	242	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK89713.1	1.15e-143	32	512	86	481
ACR77025.1	3.27e-143	35	512	89	481
CBK93417.1	3.27e-143	35	512	89	481
AOZ95022.1	4.18e-134	35	429	110	510
CBK74296.1	1.96e-132	35	516	113	522

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000033	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24