CAZyme Information: MGYG000000743_00695

Basic Information

• Species: CAG-110 sp000434635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp000434635
• CAZyme ID: MGYG000000743_00695
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000000743_4|CGC1	29504.81	7.4085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000743	2477350	MAG	Kazakhstan	Asia

• Gene Location: Start: 12726; End: 13496 Strand: +

Full Sequence      

MSVPKIIHYCWFGGNPKPKLAEKCIKSWKKFCPDYQIIEWNEENFDVSAAPEYVRQAYAA
KRWAFVTDYVRLKAMTEMGGIYMDTDVELVKPLTPFLAHDAFAGFETDASVQTGLLACCP
GFPLFQEFLQHYDSASFVKSDGTHDVTTNVSVLTSLCREHGLVPNGKFQVVDGFAVYPKE
VFCPVDFDTEQLHRTRKTVAIHWFASSWKTEEERRELEAERARLHYEKVSAARYAFFTKL
LGEKTYHKLKALFLKR

Enzyme Prediction     

No EC number prediction in MGYG000000743_00695.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	98	1.8e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	8.68e-19	3	126	82	208	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.37e-18	23	103	6	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	4.01e-08	4	93	47	140	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.007	5	44	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO36296.1	4.27e-87	2	214	6	218
AST53065.1	3.54e-84	3	214	2	212
QUT95860.1	2.87e-83	3	214	2	212
BBK91625.1	1.39e-80	3	214	2	212
QJE27088.1	3.89e-79	3	214	2	212

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000743_00695.