CAZyme Information: MGYG000000743_01521

Basic Information

• Species: CAG-110 sp000434635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp000434635
• CAZyme ID: MGYG000000743_01521
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810	MGYG000000743_12|CGC2	92329.27	5.0541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000743	2477350	MAG	Kazakhstan	Asia

• Gene Location: Start: 57351; End: 59783 Strand: +

Full Sequence      

MKTRTLNGAWTLEIPGTPFAAVPATVPGSVYHDLLAEERIPDPFYRDNEMEALKLMDNDF
VYFRSFQVDDALLAGDKVLLRAEGLDTIAAVHINGQIVGEACNMHRIWEFDVKSVLRPGE
NTITVSFRSPTKYIKEAYAKSVADGSSDAMVGFPNIRKAHCMFGWDWGPRLPDAGIWRNI
SIISIEKARIQDVRVDQFHKDGTVRLRIHTNLNRYTDDEVWVNVSVTAPDGSVLTASGTD
CELIVQNPQLWWPAGFGGQPLYQLSVSLCAKGKELDVWSRRIGLRTMTVSRHKDQWGESF
SHCVNGVDIFAMGADYIPEDNLLPRVNPERTRRLLEDAKAANMNCIRVWGGGYYPDDFFY
DICDELGLLVWQDFMFACAVYNLTDAFEENITAEFVDNVRRLRHHASLALWCGNNEMEQF
VAQGEWVTSMRQKADYIKMYEYIIPKVLKAEDPQAFYWPASPSSGGSFDDPQDPTRGDVH
YWMVWHGLLPFTDYRNHQFRYVSEFGFQSFPCMETIESFTESEDRNVFSYVMEKHQRNAS
ANGRILFYLSQMYLYPRSLELLVYASQLLQAQAMQYGAEHWRRHRGCCMGAVVWQLNDCW
PVASWASIDYFGRWKALHYYEKRFFAPVLISCHEEGILSQNTNVNAEPFGLKKSAHLNVS
NETMQEFRGKAKWSLRRPDASVIEEGSFDVTVPALSAVWLPEQDFSNYGTYDTYYSYQLL
DEAGNVVGEGSVLFCAPKHFRFADPELNAFVKDDDIIVTAKGYARSVEIQAGADVVLSDN
YFDMDGGVKAVKILRGSVDSVSVRSVWDIR

Enzyme Prediction     

No EC number prediction in MGYG000000743_01521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	693	1.3e-111	0.6914893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.66e-101	1	673	10	690	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	5.56e-15	61	453	112	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	7.01e-14	188	285	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	1.04e-12	656	739	4	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	2.47e-11	10	289	35	280	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE69834.1	0.0	1	810	1	811
QTE73768.1	0.0	1	810	1	811
AHF25065.1	0.0	1	810	1	810
AHF25196.1	0.0	1	810	1	823
AEF82182.1	0.0	1	810	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	5.19e-152	1	810	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	5.33e-152	1	810	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	3.81e-151	1	810	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	3.91e-151	1	810	3	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.60e-149	6	808	11	836	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QYN2	1.77e-118	5	635	8	663	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q4WAH4	1.02e-116	26	635	32	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q0CCA0	1.91e-116	24	692	30	728	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1D911	3.93e-116	26	635	32	663	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B0YBU9	3.93e-116	26	635	32	663	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000026	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000743_01521.