CAZyme Information: MGYG000000745_01769

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000000745_01769
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1273		138279.26	4.3058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000745	2615728	MAG	Kazakhstan	Asia

• Gene Location: Start: 4657; End: 8478 Strand: -

Full Sequence      

MKKALLIFMALLLALLPAAPLAEDEALTQAEAVYGTPVVDGNADDEIWQKATAYTVGSGE
TSGQFKAVWDDNALYLLAVVDDTTLDKSSSAIYQQDSIELFLDELNNKSNSYADDDVHYR
VNYDNERSVDNGEAPRWYTKTTIRYDGEGNAIGYIVEACFQWNKGTPANDAVMGFDVQIN
VCSGGSRQSAPALFDKTGNAYQNTALFGEIRLKGKGENDQTPAYPYGLLYYIEEVEGRNL
SVFKNPEVVDEPLANGKTIAGSGNATQEQIDAAYRAIAEALKQLDDGSGMPNAEALPDLN
GIPDMMKFNDGSDVVTAADWAKRREEIMEYYQYYMYGYMPDKSQETVTYAIKDNIQNGED
KGGKILEITVEANGKSATFDVLFTLPDPATNPAPQDGYPYFIEYAGYKMNFWGMEWYTGP
SSNQTFAANRGYAGVAYDPTAVASDSDARTGAFYELYPYGDDYKSQNGSLLGWAWGVGKI
IDALEAGAATELNINPEYSLVGGVSRYGKGAAVAGAYEKRIKVVIPSCSGAGGLAIYRTN
NSGKKYDLSMVGGAKEWVNDSANEPLSNLQGGESYWFCGNFAKIPGVEAIPVDQHMLAAM
MADPNRHMIIVTGMTSEGWNNTEGQALAYVASQEAWELLGCGDHNNMIIHENGHAILTSD
MQYILDYCDVHLYGKDPSEVESDLTKMKGNLFLEGNRDVLYDEFEPYLYSVTSITADAAV
AYGADVTVNIETSIPVKRPIADGEMTLVAQLVENATGKPVDSWQLPVPGIAEKGYKTSIS
WQVYSDQIDAKDAEHYSLAVCLAEGPADRAVVTTKDVLKIEITPLEKIFYLLFQNGPAIG
RTREMTFAVRIVGKHLLESEKVLSFVGSMSSGGNSTVIPGASITFTADGEDNVTINRSLP
SEAEDGASIRYYCAAEELEAKFNIVVVDMVSQAPELNAREFGGSRLSSVTGSSTMICTVQ
KTNNVALRSAPAVAANTFLTWLPRNAEVIVYGATEGGAWAYVSTSDMSTKGYVQTKYLKE
QGTRLEVGDTWADAPHYDGLADIKERTYVYAAPSTSAAKVDYLSQGDKVSITMLVTAEDN
KNVEWLLIRTESGIVGYIPNAKARQTLSAGATVYSFNAGATVYVHGTKSLRLRAEPNGAF
IDWLTEGTAVTVIQDQGNGWVKVSSDKGDGYVMSRYLDSRKALESGDAMIEVIGEVQAGY
FEAGSIAVVNSSNELNYRNGPGYNFDKLNTYGNGIKSGTCVTVVSDNGYGWVKIIHPDTG
EQVWVSRSFLAKP

Enzyme Prediction     

No EC number prediction in MGYG000000745_01769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	302	673	3e-71	0.9888475836431226
CBM9	39	212	7.4e-41	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00005	CBM9_like_1	9.53e-59	30	212	2	184	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
pfam06452	CBM9_1	2.29e-42	39	213	1	182	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd09619	CBM9_like_4	9.31e-20	36	208	1	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd09620	CBM9_like_3	2.17e-08	39	103	1	76	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd00241	DOMON_like	8.53e-08	57	180	14	145	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE69547.1	1.89e-159	287	708	22	438
QUA54463.1	6.95e-157	290	708	1	414
QTE70682.1	7.42e-151	290	708	1	414
QTE74645.1	7.42e-151	290	708	1	414
ADQ41707.1	5.67e-129	34	679	1077	1691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NN3_A	8.07e-71	302	679	24	373	ChainA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NN3_B Chain B, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NN3_C Chain C, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NN3_D Chain D, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B]
7NWN_AAA	1.78e-44	34	225	27	215	ChainAAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWO_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWP_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NWQ_AAA Chain AAA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B]
1I82_A	5.26e-33	30	212	3	187	Family9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Cellobiose [Thermotoga maritima],1I8A_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Glucose [Thermotoga maritima],1I8U_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a [Thermotoga maritima]
6RU2_A	2.62e-26	293	655	7	325	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RTV_A	6.20e-26	293	655	13	331	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RLB8	1.15e-82	291	704	370	762	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1
C6CRV0	4.56e-34	23	216	861	1053	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P36917	1.94e-31	30	215	860	1045	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
P38535	3.11e-31	30	215	712	897	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
D8QLP9	2.93e-29	300	678	34	364	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999105	0.000170	0.000175	0.000155	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000745_01769.