CAZyme Information: MGYG000000747_00668

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000000747_00668
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000000747_25|CGC1	40410.53	4.5681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000747	2418810	MAG	Kazakhstan	Asia

• Gene Location: Start: 6402; End: 7454 Strand: -

Full Sequence      

MIGLEPGWHTHAYSCTYQWSDKYPNPDEFIAYLKDRNFHINLWEHAFVHPDAEIHDALIP
HSGDWLVWGGLVPDFATPEGRRIFADYHRTKLVDHGIDGFKLDECDSSDFTGSWSFPLSS
EFPSGLDGEQYHSLFGTLYAKTILDALGEQQTLSEVRQMGALAAPYPFVLYSDLYDHRDF
IRGLVNSGFSGLLWTPEFRQAETREECIRRIQCIVFSCQFLVNSWNYDGIPWVIFDCEDE
VRELIQLRYQLIPMLKKAFEVYHATGKPPIRALVMDYTQDDATYTIDDEYMFCEELLVAP
IAANTGDQRSVYLPRSARWADFYTGEEIILPENGVIQVNTKRIPVYRKIG

Enzyme Prediction     

No EC number prediction in MGYG000000747_00668.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	4	349	3e-58	0.8384074941451991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	1.21e-86	2	319	37	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	3.44e-54	15	346	73	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	1.50e-50	15	350	311	667	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06603	GH31_GANC_GANAB_alpha	7.03e-25	231	350	303	423	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PRK10426	PRK10426	1.51e-19	16	348	260	619	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97813.1	8.58e-138	1	348	227	570
QEE27877.1	3.19e-118	1	350	278	644
QUL53409.1	8.55e-117	1	350	241	607
AFH61128.1	4.91e-116	1	348	241	605
AFC28899.1	4.91e-116	1	348	241	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XPO_A	2.49e-74	1	350	263	630	Crystalstructure of a novel alpha-galactosidase from Pedobacter saltans [Pseudopedobacter saltans],4XPP_A Crystal structure of Pedobacter saltans GH31 alpha-galactosidase complexed with D-galactose [Pseudopedobacter saltans],4XPQ_A Crystal structure of Pedobacter saltans GH31 alpha-galactosidase complexed with L-fucose [Pseudopedobacter saltans]
4XPR_A	3.62e-73	1	350	263	630	Crystalstructure of the mutant D365A of Pedobacter saltans GH31 alpha-galactosidase [Pseudopedobacter saltans],4XPS_A Crystal structure of the mutant D365A of Pedobacter saltans GH31 alpha-galactosidase complexed with p-nitrophenyl-alpha-galactopyranoside [Pseudopedobacter saltans]
5F7C_A	4.40e-20	1	328	343	689	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
1XSI_A	1.45e-19	15	328	316	644	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
2F2H_A	1.45e-19	15	328	316	644	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AW25	2.44e-19	16	316	330	652	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P31434	7.92e-19	15	328	316	644	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q9F234	9.31e-16	21	350	312	671	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P79403	4.43e-14	1	350	409	807	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
P32138	2.21e-13	20	339	310	652	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000747_00668.