CAZyme Information: MGYG000000747_01076

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000000747_01076
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000000747_52|CGC1	38704.19	5.1762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000747	2418810	MAG	Kazakhstan	Asia

• Gene Location: Start: 5840; End: 6871 Strand: -

Full Sequence      

MDYQQIGNLVMNRLKNSPGDGSWNDHLSLATWEWPQGVAMYAMMKLYLSTRDPALLAEIQ
AWYAGHISRKLPEPNINTTAPMLGMVLLYEETKEAQYLPLIEAWAEWVMTGLPRTEEGGF
QHITSDCVNAQQLWDDTLFMTVLFLYRAGVALNRPAWQEEAKYQFLLHIKYLHCAKNGLW
YHGWCFIGRHHFGEAFWARGNSWFTAGAVDFVEWLPEGDPVRRIVLETWREQCRALAACQ
DAETGMWHTLLDHADSYVETSASAAIAYGLLKGGRLGLLDADCLRAGHKAAEGVLGQVQA
DGTVGQVSYGTPMGMDLDFYRNVPIRPTAYGQGLTFLMLTELM

Enzyme Prediction     

No EC number prediction in MGYG000000747_01076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	26	342	2e-103	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.26e-89	32	339	34	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.03e-86	32	341	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00968.1	9.76e-110	2	341	3	341
AGI39070.1	1.96e-109	2	341	3	341
ANW98431.1	1.96e-109	2	341	3	341
AGC68039.1	1.96e-109	2	341	3	341
AGC68046.1	2.98e-108	5	342	9	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.35e-92	20	341	53	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.27e-90	20	341	54	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.61e-82	20	341	35	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	6.15e-17	32	297	23	301	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	5.82e-16	160	333	228	401	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	4.32e-43	32	343	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	7.64e-09	140	295	1	167	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	7.64e-09	140	295	1	167	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	6.52e-08	80	343	149	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000747_01076.