CAZyme Information: MGYG000000747_01539

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000000747_01539
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536	MGYG000000747_99|CGC1	60598.62	5.482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000747	2418810	MAG	Kazakhstan	Asia

• Gene Location: Start: 3976; End: 5586 Strand: -

Full Sequence      

MNMRLPDLITLYTETEKRAFTGAEGGFNDVRYTLTETAEGLEVCVSADETPLTYLRLRWH
FGITEKRYEPLRIYGDAWERGGGDLEWRGIVPERCMPWFCLVSNGTDAYGQREGRKTDGF
GVKVRPGALCFWQYDASGVTLWMDIRNGGSGVLLQGRTLHAATVIFRTYEACTAFEAGQQ
FCHAMCQDPLTTTQPVYGSNNWYYAYGVSSQAEILRDTGIVARLCQGNENRPFMVIDDGW
SPNPKNGPWTRGNGAFPDMAGLARQIKAQNVHPGIWVRYIYDEGHVCQVPEAWHMAHDAN
YLDPSRPEVLDYIRATTENFVAWGYELIKFDCSTQDILGRRGYKVPYVVAPDGWHFFDRT
KTSAEIIQNFYRTVRQAAGESTILLGCATIPHLCAGLVHLGRTGADVNGKVWDITRRMGV
NTLAFRMMQHNAFFAVDADCVGITGLFPWHFTRQWLDILAKSGTPMFVSCKPGVLSDAEN
EELRQAFARNALQRDTLIPLDWMENICPERWLLNGQEIAYDWFGDDVPVIFDGKSL

Enzyme Prediction     

No EC number prediction in MGYG000000747_01539.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.03e-29	195	489	2	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14790	GH_D	7.03e-05	228	455	29	219	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.
COG3345	GalA	2.32e-04	198	444	295	568	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU96820.1	3.01e-169	1	523	6	523
CBL19648.1	1.45e-168	5	530	30	547
QCU01578.1	4.13e-168	5	530	30	547
BDA09953.1	3.68e-163	1	536	6	538
QIB59833.1	1.48e-162	1	523	6	526

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000747_01539.