CAZyme Information: MGYG000000748_00056

Basic Information

• Species: UBA10677 sp900762945
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp900762945
• CAZyme ID: MGYG000000748_00056
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713	MGYG000000748_1|CGC1	80044.07	5.3505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000748	1946382	MAG	Kazakhstan	Asia

• Gene Location: Start: 69156; End: 71297 Strand: -

Full Sequence      

MAIYFNEQSKTFYVESKNLSYVFKVNEHGFLQHLYYGKRVPRENLDFSVALPDRGHGCCL
PGSDRRQSMDEYKNECPTFGRSDFRESMIDFTFNSGVVGDLRYDGYEISESKPALSGLPS
VRGGQTLIVTLRDEVHGAAVRLYYTAFEDLPVILRHAEITNESAEPIALCRAYSFAVDFP
RKNYDAITLPGAHLRERRIEKTRLGHGTFTVQSKRGVSSSQMNPFMAIADYTATETQGEV
YGFNLIYSGDFAFRAEVGQCEYLRVTGGLNDYGFDKTLKSGETFVTPEVVAVYSDEGLGK
MSRAFHDLYRDYLVNPHRAKSPRPIVINNWEATYFDFDTDKLCAIIDSVEGTGIDTFVLD
DGWFGARNHDRAGLGDWVVNENKLRGGLGGVIDHAHAKGLKFGLWFEPEMVNADSDLFRA
HPDWIIRADGVEPCPGRDQYVLDLSRAEVRDYVVTAVSKVLRNNAIDYVKWDMNRALSET
RCHHDYVLGLYEVFDRIIGAFPNVIFEGCASGGCRFDPAILYWFPQIWTSDNSDAYARTA
IQYGTSVCYPLSAMSCHVSVCPNHQTGRNTPFASRAAIAHLGATGYELNPNNLSDKDKAE
IKAQVDEYKAMESLVLTGDLYRLNNPVEENLFAEMLVSKDKREAVLTAMRPLSAANGESV
ILYPGGLDENADYELLPQKITRKGATFIRAGIVAYFPFGDFGTVVYKFRKVEE

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	12	692	5.6e-243	0.9941860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	4.49e-179	12	711	4	687	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	4.21e-175	283	618	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	1.48e-134	322	610	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	1.58e-91	29	279	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	2.79e-10	635	708	5	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20708.1	2.55e-210	1	692	1	711
AFK85721.1	1.85e-208	1	711	1	729
AJD90308.1	1.36e-207	3	713	11	737
QCQ03635.1	3.72e-206	3	713	5	732
ADL67728.1	6.76e-206	1	711	1	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	1.49e-200	1	713	1	729	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	3.07e-197	1	713	1	729	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2XN0_A	3.38e-197	3	712	6	732	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	9.56e-197	3	712	6	732	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNT_A	1.74e-196	1	713	1	729	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43467	1.69e-197	6	713	7	732	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q9ALJ4	1.68e-196	1	713	1	729	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	1.85e-196	3	712	6	732	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
G4T4R7	1.03e-186	1	692	1	701	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q2TW69	2.78e-159	10	710	41	750	Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000748_00056.