CAZyme Information: MGYG000000748_00575

Basic Information

• Species: UBA10677 sp900762945
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp900762945
• CAZyme ID: MGYG000000748_00575
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	MGYG000000748_11|CGC1	65941.44	8.7585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000748	1946382	MAG	Kazakhstan	Asia

• Gene Location: Start: 12285; End: 14081 Strand: -

Full Sequence      

MAESKVKTGAKKAAEKKTAVPVVKAETKPAVKKTGTAVVKKTAKPAVKETAAPAVKKTSA
PAVKKSGAVTKTAAAKEAEKTALTPAAQEVYPVTETEVKPKAKRGRKPKATEAAKPAETP
KKKRVLFVASEAWPFAGTGGLGEVVGSLPKALNGLGDVEAEVIIPLYESVPAEYREQMTF
VRSINVPLAWRNQYCGLFTLVHDGVKFMFVDNEYYFKRSGLYGYGDDGERFAFFSRAVLE
LLPYLDYKPDILHCNDWHTALVPVYYKLFYQYREGLSGIKTIFTIHNIEYQGQFSGDVIE
DLFGISRREYMSVEYHGCINLMKAAIDYSDSVSTVSNAYAGEIMSAEYAHGLEGVLLKNA
YKLKGILNGIDVKTYDPATSASLFKNYDAESAEANKKENKLGLQRMLNLPADENVPMIAM
ITRLASHKGLDIVRSAFNGIMQDDVQFVVLGTGDADHENFFRHMQNVYGNRVRAIIAFNK
DMAQKIYAGADIFLMPSKSEPCGLSQMIAMRYGTVPVVRLTGGLKDSVTDCGDGTVGTGF
GFTEYDAGALRHAVDRAVGLYRDYRDIWNGLKKRDMESDFSWNKSAKDYDAYYAEVLE

Enzyme Prediction     

No EC number prediction in MGYG000000748_00575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	124	594	3.2e-172	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00654	glgA	0.0	124	597	2	464	glycogen synthase GlgA.
COG0297	GlgA	0.0	124	597	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	124	595	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	0.0	124	596	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	1.77e-108	124	598	5	481	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18264.1	9.89e-179	124	598	2	473
ASB40510.1	1.24e-174	124	598	2	474
QQR29794.1	1.24e-174	124	598	2	474
ANU52824.1	1.24e-174	124	598	2	474
QAT49200.1	2.30e-172	124	598	2	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	2.63e-86	125	593	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
2QZS_A	3.20e-84	124	598	2	479	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.45e-83	124	598	2	479	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
3D1J_A	2.11e-82	124	593	2	473	ChainA, Glycogen synthase [Escherichia coli]
4HLN_A	3.61e-82	123	593	125	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6TSC8	8.67e-155	124	589	2	467	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
Q97GX6	1.24e-149	124	597	2	477	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
Q8XPA1	2.08e-149	124	598	8	482	Glycogen synthase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgA PE=3 SV=1
Q6HC18	1.36e-148	125	598	3	476	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2
B9J2G5	2.19e-147	125	598	3	476	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000748_00575.