CAZyme Information: MGYG000000752_00210

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000000752_00210
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000000752_2|CGC2	61124.78	4.7007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000752	2697118	MAG	Kazakhstan	Asia

• Gene Location: Start: 68941; End: 70590 Strand: -

Full Sequence      

MKLLDERVRETIFPVRVIKAFGNVKNAEMLTKPKPLQIGLKEPECTVFENGKDGENAGIL
LDFGKEINGCVRIMTYSCGNAGIAKARVVCGESVTEALSEIGRKNATNDHAVRDFETELR
PFSDMTFNETGFRFVFFELKGSNTELVIKSISAVAVYRDLPYLGTFSCNDPTLNKIYSTC
AYTCHMCLQSYIWDGIKRDRLVWVGDMHPEMLTVRTVFGDITLMAQTLEYIKNATPLPEW
MNNMPAYSLWWMIIVRDWYLYTGSEEFLKENAEYILALSKQVFTAVSDSGEDSLGSYFLD
WPTNETAAGKYGTRALLVIALKAAEELCGYCGDENTAEVCREKAEILKKCRWDFCSAKQT
AAIISLAGCCDEKKAADEILKGGAAGFSTFMSYYLLKAAAKKDMQAALCTLKEYYGAMLD
FGATTFWEDFDIKWAENAAPIDRIPASGESDIHGDNGDFCYKGFRHSLCHGWSSAPTAFL
AEEVLGIHILSPGCETVEIKPNLGGLNWAKGTFPTPHGLITVSCEQNENGDMQVDWTAPE
NIRVICDFS

Enzyme Prediction     

No EC number prediction in MGYG000000752_00210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	57	543	6.7e-94	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.30e-16	164	431	4	313	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.73e-05	486	541	1	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE16159.1	1.76e-171	8	545	39	583
QEC52590.1	1.90e-168	5	545	39	586
ATP57578.1	3.35e-168	9	545	41	583
QNL50446.1	6.08e-168	9	545	40	579
QGQ98689.1	3.48e-167	5	545	10	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.38e-37	34	522	170	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.18e-11	59	482	95	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000752_00210.