CAZyme Information: MGYG000000752_00225

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000000752_00225
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729		79873.63	5.1616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000752	2697118	MAG	Kazakhstan	Asia

• Gene Location: Start: 98941; End: 101130 Strand: +

Full Sequence      

MRLSTANEKMIEELLGKMTLKEKIGQLYQVGPSPVGGFNISAEDARQMLESGKINEEEYT
AIIENSLLDGREDMIRDGLIGSFIGINDRRKANRLQKIAVEESRLKIPLIFSMDVVHGHK
TIFPVPLGESCSFDRDLFYQTARAAAKEAAEDNVNWTFAPMIDVSRDARWGRVAEGAGED
TYLTSVFAKAKVKGFQGDDLSSPDSIAACAKHFAAYGACEGGRDYNTTDMSLNRLNEVYL
PPFAAAAAADCATFMAAFNDLNGLPCTMNPFLLKTVLREQWGFNGAVISDAHGIEECIAH
GTAADPADAAAKALKAGVDMDMGTEFYTNHLEELLDSGKIEIKDIDTAVRNILRLKAALG
LFERPYAKKPEKSCALSPEHMALAKKAAVKSAVLLKNTGVLPLDKKEKIAVVGFFADSAF
DMLGTAGQISGSENDVITLVSELKNRKTNFTYSPCTDTSYSLNSDELNKTVSGCDTVIAC
IGERLCESGEANSRSDISPAGDQNKMIAQLRKAGKKVITLLFTGRPMAISETAENSDALL
AVWHPGTQAGPAICDLLFGDETPSGKLTMTFPQNSGSMPVYYNHVPTGRPADETNWTSKY
KDCPYTPLFPFGYGLSYTKFDYYDFKCEFKNSHLLCSVKIKNTGDFAGEETVQLYTHRLD
AETTRPVKELKAFKKVFLLPGEEKTVEFSVTHSRFAYYDFGGNIINNKSRYEVFIAPDSA
SGEPIYITF

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	101	322	9.9e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	6	720	33	755	beta-glucosidase BglX.
COG1472	BglX	1.41e-80	18	445	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.43e-73	19	355	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.03e-55	121	690	112	742	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	9.79e-48	392	617	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR96724.1	1.78e-228	8	722	70	791
AQR96754.1	7.77e-228	8	722	17	739
AGF58064.1	4.42e-227	8	719	17	736
QLG40515.1	4.17e-223	8	719	32	733
QQA36870.1	3.20e-208	1	723	1	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	5.30e-173	8	719	11	741	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.60e-172	8	728	10	749	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXN_A	2.97e-172	8	719	11	741	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	2.85e-165	5	723	1	726	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	1.17e-164	4	723	1	727	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	3.29e-166	6	720	33	755	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.45e-164	6	720	33	755	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	4.13e-95	88	690	47	681	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.36e-90	8	719	37	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	5.23e-84	6	713	34	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000752_00225.