CAZyme Information: MGYG000000752_00342

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000000752_00342
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747		85734.9	4.8512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000752	2697118	MAG	Kazakhstan	Asia

• Gene Location: Start: 74896; End: 77139 Strand: +

Full Sequence      

MQFPKQYICYDNETGSLDNPVRTPYFRRKFTLECLPDSAIIRITGLGFYRLFINGQEITK
GYLAPYITAPDRLVYFDDYEVSKLLTVGENCIGVWLGNGIWNNPGGYPWEIEKAHWRAAP
QFAMRFESFGAENFAFETDEQFLAAPSPIVFDDFRFGERYDARLEEDGWSCADFCDLAWR
PAIFAKAPTGENVMCPVKPIVTEEIITPVSIKKLKDSYLYDFGKNGAGVCKIRINGFAGQ
CVELQYGELLEESGDVQLKHQWFDDRKGFNRDAYICRGKGEETHKALFTYHGFRYVQVYG
ITEEQATKALLTYHFMHSQVDILAGFSCSDETVNALYNMTRRSDLSNLYYFPTDCPHREK
HGWTGDAAFSSEHMLQNLSVDEYYHEWLHQMRAAQRPDGLIPMIVPTAGWGYHSSVGFDY
ALIEIPWRLWQYRGDKKAIEDNADAMWSLMTYFVNHSTQDGFDDYGIGDWSPVNAKQWIY
ISPVAFTNTLIAKYACEKAAQMFRVIGQKRRASYAEMLAKWFKENLREKMVDFDTMTAEG
SCETSQAMAIYYGLFEPDEIPRAVEQLIEIIHAAGDVIDTGILGFRIIFHTLTEYGFSEL
AYRMIIGPKSPCFGDWVRQGETTMREQVVPDKDGICSHNHHFWGDISGWFMRNLAGIRVN
DLGEDVHHIDLKPQFINLLEYVDAWEISVDGKITVNWKRNESEILLTTEVPNGCHGRIVL
PENYVFENLSGECELKSGSYKIIQNEG

Enzyme Prediction     

No EC number prediction in MGYG000000752_00342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	214	720	1.6e-115	0.9900793650793651
CBM67	6	184	7.6e-26	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.05e-62	326	654	6	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.38e-35	38	203	5	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.09e-19	212	307	1	93	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.85e-05	668	721	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH83620.1	1.25e-134	24	742	141	872
AYD48149.1	4.66e-130	24	721	157	859
QGQ94103.1	5.78e-130	7	747	127	874
QDK77891.1	2.58e-129	24	742	159	875
QMW03094.1	4.96e-129	24	742	158	874

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.96e-95	24	747	177	919	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.85e-67	35	724	311	998	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.42e-55	8	721	117	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	7.67e-79	6	746	162	951	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	4.13e-68	25	724	172	882	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.91e-66	35	724	311	998	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	6.41e-57	15	746	165	905	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000006	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000752_00342.