CAZyme Information: MGYG000000752_00752

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000000752_00752
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		58557.39	6.9028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000752	2697118	MAG	Kazakhstan	Asia

• Gene Location: Start: 25138; End: 26772 Strand: +

Full Sequence      

MKLKSRNILCLLAAAALLFSVCGCKKKATESSSAAPAPTIEAPTADDKQDPENADITEEK
GAKADSENLTVKEGMANGIDVSKWQGKIDWSRVKGSGIDFAIIRIGFRGENGTIYKDSAA
DYNLQQAEKAGVLCGVYFFSTALSEKEAEEEADFTAAAVAGYSVSYPVVYDCEGFRDSDS
RMYGVTNTQRTNNALAFLNRIKAKGYEGMLYSAVKELSGSAYWDTARLESAFSVWVARYP
AEPYPKTAHPDYSGKYDMWQYTDNGTVAGIGGNVDMSVAYFTRQKAEPKNKSARPGAAAA
PSKEDSVYTAVSDKVTPKIEVNLRTAATTKSDVAANIKNGTVLNRTGIGSNGWSKINYNG
KTVYAITSYLTTDLSAKAPESKPDDGFTAASGKVTAKDETNLRAEPSTDGKLIATIKNGE
FVEKTGESPKGWTRLLYNGQTVYAKTSLLTTEVKKPAASSETPSAADEFVAATGKVTAKD
IVNLRSSPNGKEDNIVCQLKKGEFAERLATNGGKGWTRLSYNGQTLYAVSSMLITEEEYN
KQNS

Enzyme Prediction     

No EC number prediction in MGYG000000752_00752.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	79	270	1.7e-45	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.99e-71	78	280	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.13e-40	78	279	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	3.34e-32	79	270	1	180	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	1.49e-26	78	278	2	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06525	GH25_Lyc-like	5.64e-25	77	276	1	181	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR73526.1	5.21e-112	48	449	86	504
CBK89713.1	5.68e-108	8	452	16	484
ACR77025.1	3.17e-107	8	452	16	484
CBK93417.1	3.53e-106	8	452	16	484
CUH92515.1	4.98e-98	78	449	104	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	3.99e-17	78	275	7	198	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRT_A	1.27e-15	78	435	22	335	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRU_A	2.46e-13	78	277	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
3HMC_A	2.14e-09	75	271	4	172	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
5A6S_A	2.23e-09	80	277	26	199	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	8.04e-16	78	275	84	275	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	2.02e-14	78	435	11	324	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
Q8X7H0	1.00e-08	77	285	68	260	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	1.35e-08	77	278	68	253	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	2.42e-08	77	278	68	253	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000029	0.001405	0.998563	0.000004	0.000029	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000752_00752.