CAZyme Information: MGYG000000752_00828

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000000752_00828
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	MGYG000000752_13|CGC1	59544.27	6.3941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000752	2697118	MAG	Kazakhstan	Asia

• Gene Location: Start: 7168; End: 8754 Strand: -

Full Sequence      

MSKLNIIKPVYTDELYTPIAVKKKFYLKNSSELLNKKAACVSFNTDRYTTFMRKGAYVLL
DFGQELCGGVRFITRKTKGTARVLIRFGESVTEAVTPVGIKNSTNDHSPRELTVSITTLS
DLCFGQSGFRFVYIELLSDNAISFQNIFAVNHLQVFPFEGEITTNDAKVNDIIKTAVYTL
KLCCQNNCIWDGIKRDRLVWSGDMHQEILSVLYMFGNIENIKNSISFVRNDTDLSFWVNW
MPSYSAWWIINLCEYCRVSGDIEYFEENADYAAATLKKINASISDEGNMVLENTVMPYFL
DWPTVGTEDAVCGTASLFILAAKAFRKFRENAEADAIIRKLSQVLEKSSPVTKQAITFAY
LAGKKFENLPKILENGGAHGFSTFMSYYIIKADVAENGKNAIDIIKQYFGAMLERGATTF
WEDFNLDWMNGSGRIDKFPKSGQKDIHGDFGAYCYKNFRHSLCHGWSAGLLAFFVEEVIG
LKINNGTVCEITPNLMGLEYVKARLPFGNEILNIIVDENGVKCVSEQL

Enzyme Prediction     

No EC number prediction in MGYG000000752_00828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	54	507	8.3e-57	0.9246031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.62e-05	160	457	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.006	52	89	3	38	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48045.1	1.11e-107	35	514	54	559
BBE16159.1	1.47e-105	27	522	59	571
ADQ17461.1	5.08e-103	59	514	76	539
QEH42293.1	1.05e-99	11	514	32	552
BCA48698.1	1.45e-99	32	506	68	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.22e-23	58	522	194	682	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.33e-10	7	477	46	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000752_00828.