CAZyme Information: MGYG000000752_01399

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000000752_01399
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	MGYG000000752_27|CGC3	91902.99	4.7233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000752	2697118	MAG	Kazakhstan	Asia

• Gene Location: Start: 31781; End: 34204 Strand: -

Full Sequence      

MLLNGEWKCMLFKEGSAPQTFSAAVPGCIHTDLKRAGVIGDYFYRDNAEKIRWIENCDVT
YQNQFDVDSVENNEYLRFEGLDCYCDIYLNNIKIGSADDMFIPYEFSAENVLRAGTNLLE
VKFRSPIKEVAGRPKRDGAFTTERLYTRREQCTYGWDWVTRFVTMGICGDVSLKKRETDS
LDNIYIYTKGITPFAASVAVEAAFKDISGDGFADFEIISPQGETVFSEKRAIFESLIKMT
ADIPNAQLWFPTGYGEQPLYKLKITVNGKESITEFGIRKVDILEIDDNFNPEYKAKAEKL
KKNPHLLENDRNEKTSAFWLVINGVRIFCQGGNWVPCDPFVSEETDEKIKSLVQSAHECG
YNMLRVWGGGVFEKDSFYSECDRLGILVTQDFLMACGTYPEDDKDFLDKVARETAAAAVR
LRNHPSLVWWSGDNENAVDGYFNKKSFPGKTVVSKSIAPVLSRLDPQRTFLLSSPYGGVP
FKSAACGTTHNTAYLGDWFDFVSGETPFDYYNEINRYLSRFMAEQPSYGLPFVSSLKKFL
TDEDIFGKNSDIMEYHCQNNPCLKETIFAYSEKMAEEFFGKYESLRDRIYKLQLLQCEWL
RVSFELFKRNQWFSSGIVYWMFNDCWPASVSWSVVDYYGNPKPAYYVFRRCAKPVITSLY
EEDGEIKAYVCVNGKNGVSAKGRVYLYNVLTGEENTLAEFDGKFSVGSTCAAAIEKSKIP
QIEQNENIVLCDLESDICSDRSFYCPNYFKNVPWGKNDAFVLTETGEGCEITADTCIPYV
MLDTEGKLSDNCFFLKKGETVTLKIGK

Enzyme Prediction     

No EC number prediction in MGYG000000752_01399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	675	2.5e-78	0.6316489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.55e-51	3	716	15	687	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	5.03e-07	3	122	4	132	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10340	ebgA	2.13e-06	61	437	113	451	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	7.13e-05	762	805	8	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	8.05e-04	58	468	66	443	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI36571.1	6.55e-171	1	803	5	830
QJD84958.1	1.83e-170	1	803	5	830
ACK43074.1	6.34e-115	3	744	6	704
ACI19676.1	4.77e-114	3	797	6	809
AJS61217.1	1.58e-112	1	805	1	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	6.18e-114	3	797	29	832	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	4.19e-87	3	805	8	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	4.27e-87	3	805	8	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	8.49e-87	1	670	9	669	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	8.80e-87	1	670	11	671	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	7.33e-82	3	801	25	853	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	1.85e-80	3	801	25	853	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
O00462	5.70e-77	3	669	25	705	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q4FZV0	2.54e-74	3	669	25	705	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q8K2I4	1.21e-73	3	669	25	705	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000752_01399.