CAZyme Information: MGYG000000754_00489

Basic Information

• Species: Streptococcus sp900555155
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900555155
• CAZyme ID: MGYG000000754_00489
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000000754_52|CGC1	33947.12	5.0079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000754	1511164	MAG	Bangladesh	Asia

• Gene Location: Start: 56; End: 937 Strand: +

Full Sequence      

MLITVLAAQKGQASQADFDNLYRYYQNHRIEGTQLMSWKQVIKNGSETVKKQNATDGDLY
IAYSLIEASKQWPDKAQEYQEQAKKILEDILRYNYNKETGVLTVGNWANKNSDYYYLMRT
SDTLPHYFQSFYDLTGNKQWLDVKDKMLGQLEQISSQSDTGLLPDFIWAEKSGARLVDAN
TIESQYDGAYSYNACRLPYHLSQSQDERSQKLVQKMMNFFMKEQRIYAGYDLNGTALNQY
QAGSFLAPISYASDKGEGYLKLLQQNKYIFTQDLPLDNYYDATMITMIALEMF

Enzyme Prediction     

No EC number prediction in MGYG000000754_00489.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	1	289	5.5e-62	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	2.24e-19	15	290	50	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	2.55e-16	1	222	62	277	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	2.88e-05	15	92	70	150	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANR74454.1	3.37e-213	1	293	75	367
ATF56361.1	1.95e-212	1	293	75	367
QLL99084.1	1.95e-212	1	293	75	367
QQL00752.1	8.45e-207	1	293	75	367
QRO06681.1	8.45e-207	1	293	75	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	3.90e-34	1	253	101	364	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	2.02e-23	1	253	80	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	2.24e-23	1	253	86	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	1.96e-08	35	202	70	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
3QXQ_A	2.31e-06	15	192	49	227	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	2.14e-33	1	253	101	364	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	8.54e-21	1	248	136	391	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P27032	4.84e-07	18	201	71	248	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998745	0.001307	0.000003	0.000002	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000754_00489.