CAZyme Information: MGYG000000754_00989

Basic Information

• Species: Streptococcus sp900555155
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900555155
• CAZyme ID: MGYG000000754_00989
• CAZy Family: CBM71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		87695.48	4.9201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000754	1511164	MAG	Bangladesh	Asia

• Gene Location: Start: 1038; End: 3407 Strand: -

Full Sequence      

MVRLDSKKGTSITEVQIFAKQVAAAKQGQIRIQVDGKDLANFNPDLTDYYLESVDGKVPA
VTASVSNNGLATVVPSVREGEPVRVIAKAENGDILGEYRLHFTSNKDLLSRKPVAAVKQA
RLLQVGQPLELPTKLPVYFTGKDGYETKDLAVEWEEVPAENLTKAGQFTVRGRVLGSDLV
AEFTVRVTDKLGEALSNNPEYDENSNRAFASATNDIDRNSHDRVDYLNDGNHSENRRWTN
WSPTPSSNPEVSAGVIFRENGKIVERTVAQAKLHFFADSGTDAPSKLVLERYIGPEFEVP
TYYSNYQAYDAAHPFNNPENWEAVPYRADKDIAAGDEINVTFKAVKAKAMRWRMERKADK
SGVAMIEMTFLAPSELPQESTQSKILVDGKELPDFAEDRQDYQITYKGQRPKVSVEESNQ
VASTVVDSGDDSLPVLVRLVSESGKQVKEYRIQLTKEKPVSEKTVAAVQEDLPKLEFVEK
NLAYKTVEKKDSTLYLGETRVEQEGKVGKERIFTAVNPSGSKEEKLREVVEAPTDRIVLV
GTKPGTSLPEDEVKNLVLNRPELVIEEETIDFKVQERKSDKLYLGETRILQEGQKGIRIH
LIEVENGKRTEKESYNKVMAQDRIVEVGTKPGTALPEDEVKNLVLNLPELISEEEAIDFK
VQEQKNDKLPAGQTRVLQEGRQGIRVHLIEVENGKRTEKDSYDKVMAQDRIVEVGTASET
TKPVPQESTKPQVSEKTDTKEISSNEASQVQKEQLPNTGSAESQAALAAGLALLALGAGL
VATKRRKED

Enzyme Prediction     

No EC number prediction in MGYG000000754_00989.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM71	194	395	1.9e-85	0.9902439024390244

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07501	G5	1.73e-09	562	630	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam07501	G5	2.37e-09	478	543	6	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam07501	G5	2.40e-08	649	717	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	4.56e-06	559	637	208	291	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
COG3583	YabE	4.64e-06	448	550	185	291	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA08836.1	0.0	1	789	1624	2412
QXW62013.1	0.0	1	789	1624	2412
AHZ47439.1	0.0	1	789	1624	2412
ATF56410.1	0.0	1	789	1624	2412
QLL97214.1	0.0	1	789	1624	2412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CU9_A	5.30e-116	198	375	9	186	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae],4CU9_B Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae]
4CUB_A	3.56e-16	208	372	20	180	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae],4CUB_B Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae]
4CUA_A	1.65e-15	208	372	20	180	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae],4CUA_B Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae]
2LTJ_A	1.64e-07	634	715	22	107	Conformationalanalysis of StrH, the surface-attached exo- beta-D-N-acetylglucosaminidase from Streptococcus pneumoniae [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49610	3.65e-11	536	789	1035	1312	Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=strH PE=1 SV=2
Q54875	7.03e-07	464	637	230	399	Immunoglobulin A1 protease OS=Streptococcus pneumoniae OX=1313 GN=iga PE=1 SV=1
Q59947	7.05e-07	464	637	230	399	Immunoglobulin A1 protease OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=iga PE=1 SV=2
Q97QP7	7.07e-07	464	637	230	399	Immunoglobulin A1 protease OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=iga PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000754_00989.