CAZyme Information: MGYG000000755_01339

Basic Information

• Species: Campylobacter sp013416015
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter sp013416015
• CAZyme ID: MGYG000000755_01339
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000000755_12|CGC1	37065.2	9.4426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000755	1680879	MAG	Bangladesh	Asia

• Gene Location: Start: 24406; End: 25422 Strand: -

Full Sequence      

MICITGGGTGGHLAIAKTLATELNSRGIKCIFIGSQKGQDRAWFENSELFSKTYFLPSSG
VVDKKGLKKFLSLLNILKLIKQCHAIFKKDEICAVISVGGYSSASASMAGVLFAKPLFLH
EQNAIIGRLNALLKPFAKGFFSSYFEPKYDYPIDKKFFEGARIRKELKQILFLGGSQGAS
FINSLALNLAPSLNEMGIKISHQSGEKEFGQICESYEKLGIQADVFAFSKDMPRLMNKAD
ICVSRAGASSLWELSANALPCVFIPYAHAASDHQYHNAKFLSDLGLCVLKRQNEIDAKLM
LDIIKNMNLEQISKGLQGQISSGGASKIIDFVLENIKK

Enzyme Prediction     

No EC number prediction in MGYG000000755_01339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	170	307	1.6e-38	0.8471337579617835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.89e-100	12	338	14	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	1.83e-85	12	332	13	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	7.57e-80	12	338	13	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	9.89e-80	12	331	12	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam04101	Glyco_tran_28_C	1.58e-34	170	310	2	143	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI05390.1	2.35e-243	1	338	1	338
ARR02265.1	3.03e-144	1	338	1	338
ARR03896.1	1.23e-143	1	338	1	338
ARR00648.1	8.72e-143	1	334	1	334
ARQ97525.1	1.54e-141	1	335	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.89e-33	2	285	5	299	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	3.79e-29	8	312	18	338	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.18e-21	2	312	9	327	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0RP87	6.28e-132	1	334	1	334	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter fetus subsp. fetus (strain 82-40) OX=360106 GN=murG PE=3 SV=1
A7I265	6.80e-128	2	337	3	336	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) OX=360107 GN=murG PE=3 SV=1
Q5HU62	1.09e-114	2	333	3	334	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=murG PE=3 SV=1
A1W027	1.54e-114	2	333	3	334	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) OX=354242 GN=murG PE=3 SV=1
Q9PNQ2	1.54e-114	2	333	3	334	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000755_01339.