CAZyme Information: MGYG000000756_00322

Basic Information

• Species: Bifidobacterium sp002742445
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp002742445
• CAZyme ID: MGYG000000756_00322
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	MGYG000000756_5|CGC1	75443.5	4.8704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000756	1963853	MAG	Bangladesh	Asia

• Gene Location: Start: 10693; End: 12696 Strand: +

Full Sequence      

MKTKLFSTRPNIEITSEFWCRYRNLIVDKVLPYQWAVMSDEQDAKLPDDPSSGNSFDGNE
GHTLRNLRIAAGLEKGHHTGYQFQDSDLYKWLEAVAYALRYREDSHLRELADDLIDLIAQ
AQESDGYLVSLFQIDYPQERFKRLRQSHELYTMGHYIEAAVAYWEATGSGKALDIARGMA
DCIDRAFGPQEGKIHGVDGHPEIEVALPRLYEATGEPRYLELASFFLHERGKNPNFLDQQ
FKEGLSPCEMLNESTFSHKYYQIDKPFTQQTTAEGHAVRVVYLCEGAAHVAHLADDEQLR
AAAERLWTNIVDKRMYITGQVGSTHEGEAFTYDYDLPNDTMYGESCASVGMALFARRMLD
IEQKGEYADVLEKQLFNGAISGMSLDGSHFYYVNPLEADPALSAYNPDKKHVLTHRAEWF
GCSCCPANIARLVASVDRYLYTVTDNTIYAHQFIANRASFGHGVSVVQDSDFPRSGHISW
HVESSANTDFRFAIRIPDWAEDNYVLQINGISTAIPPRNGFITLEVPASCISMNVTLDLD
MSVRAMQANENVRADVDKVAFMRGPTVFCAEQVDNTNDLWKYRVTQEALRGGAVSQFDAD
LLGGVETICVPAVLDKNNNVKKLYYPVNHDDEADMESVSLRLIPYYAWANRENGQMLVWL
RRGDKTT

Enzyme Prediction     

No EC number prediction in MGYG000000756_00322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	13	569	5.9e-199	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	1.51e-164	18	662	22	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	3.25e-161	11	569	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04791	LanC_SerThrkinase	7.88e-04	95	375	52	275	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04792	LanM-like	0.001	95	231	551	692	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF41724.1	1.29e-262	12	662	12	655
QPI46807.1	2.99e-261	12	662	12	655
ADK14420.1	3.83e-260	11	662	11	656
ALU37778.1	3.83e-260	11	662	11	656
AGY77639.1	3.83e-260	11	662	11	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WRE_A	2.48e-242	11	662	2	658	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	3.63e-242	11	662	2	658	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.03e-241	11	662	2	658	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRF_A	1.22e-232	11	662	2	658	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217]
4QJY_A	1.39e-164	11	660	15	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.36e-241	11	662	2	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000756_00322.